Modomics - A Database of RNA Modifications

Full name:	Ribosomal large subunit pseudouridine synthase C
Synonym:	YceC
GI:	76363884
Orf:	yceC, b1086
COG:	COG0564
UniProt:	P0AA39
Structures:	\| 1V9K \| 1XPI \|
Complex:
Enzyme type:	pseudouridine synthase
Position of modification - modification:	l:955(955) - Y l:2504(2504) - Y l:2580(2580) - Y

Comments:

The multi-site specific RluC catalyzes isomerization of uridines to pseudouridines at positions 955 (in hairpin 39 of Domain II), 2504 (in single stranded region between hairpins 89-90 of Domain V in Peptidyl Transferase Center) and 2580 (in stem of helix 90 of the same Domain V) in 23S rRNA. In vitro transcript of 23S ribosomal RNA was used as substrate. RluC possess a N-terminal S4 RNA binding domain. Proteolytically derived fragment of the enzyme consisting of residues 89-319 has been crystallized and shown to retain catalytic activity. RluC belongs to the same subgroup of RNA pseudourodine synthases as RluA, RluD, TruC, Pus5, Pus6, Pus8 and Pus9.

Protein sequence:

MKTETPSVKIVAITADEAGQRIDNFLRTQLKGVPKSMIYRILRKGEVRVNKKRIKPEYKLEAGDEVRIPPVRVAEREEEAVSPHLQKVAALADVILYEDD
HILVLNKPSGTAVHGGSGLSFGVIEGLRALRPEARFLELVHRLDRDTSGVLLVAKKRSALRSLHEQLREKGMQKDYLALVRGQWQSHVKSVQAPLLKNIL
QSGERIVRVSQEGKPSETRFKVEERYAFATLVRCSPVTGRTHQIRVHTQYAGHPIAFDDRYGDREFDRQLTEAGTGLNRLFLHAAALKFTHPGTGEVMRI
EAPMDEGLKRCLQKLRNAR

Enzymatic activities:

Reaction	Substrate	Type	Position
U:Y	rRNA (r)	LSU/23S/prokaryotic cytosol	955

Publications:

Title	Authors	Journal	Details	PubMed Id	DOI
The rluC gene of Escherichia coli codes for a pseudouridine synthase that is solely responsible for synthesis of pseudouridine at positions 955, 2504, and 2580 in 23 S ribosomal RNA.	Conrad J, Sun D, Englund N, Ofengand J	J Biol Chem	[details]	9660827	-
Crystallization and characterization of a fragment of pseudouridine synthase RluC from Escherichia coli.	Corollo D, Blair-Johnson M, Conrad J, Fiedler T, Sun D, Wang L, Ofengand J, Fenna R	Acta Crystallogr D Biol Crystallogr	[details]	10089432	-
Crystal structures of the catalytic domains of pseudouridine synthases RluC and RluD from Escherichia coli.	Mizutani K, Machida Y, Unzai S, Park SY, Tame JR	Biochemistry	[details]	15078091	-
Identification of two Escherichia coli pseudouridine synthases that show multisite specificity for 23S RNA.	Huang L, Ku J, Pookanjanatavip M, Gu X, Wang D, Greene PJ, Santi DV	Biochemistry	[details]	9843401	-