Full name: | 23S rRNA (guanosine(2553)-2'-O)-methyltransferase RlmP |
---|---|
Synonym: | ysgA |
UniProt: | P94538 |
Alpha Fold Predicted Structure: | AF-P94538-F1 |
Enzyme type: | methylthiotransferase |
MKQIESAKNQKVKDWKKLHTKKERTKTNTFLIEGEHLVEEALKSPGIVKEILVKDETRIPSDLETGIQCYMLSEDAFSAVTETETPQQIAAVCHMPEEKLATARKVLLIDAVQDPGNLGTMIRTADAAGLDAVVLGDGTADAFNGKTLRSAQGSHFHIPVVRRNLPSYVDELKAEGVKVYGTALQNGAPYQEIPQSESFALIVGNEGAGVDAALLEKTDLNLYVPLYGQAESLNVAVAAAILVYHLRG
The Bacillus subtilis open reading frame ysgA encodes the SPOUT methyltransferase RlmP forming 2'-O-methylguanosine at position 2553 in the A-loop of 23S rRNA
Reaction | Substrate | SubstrateType | Position | (Anti)Codon | Modified (Anti)Codon | Amino Acid Change | Transcript Name | Transcript Region | Cellular Localization | References |
---|---|---|---|---|---|---|---|---|---|---|
G:Gm | RNA | rRNA | 2553 | LSU-23S | DOMAIN-V (A-LOOP) | Prokaryotic Cytosol |
Alpha Fold Pdb Files | AF-P94538-F1.pdb   |
Alpha Fold Pdbx/mmCIF Files | AF-P94538-F1.cif   |
DSSP Secondary Structures | P94538.dssp   |
Title | Authors | Journal | Details | ||
---|---|---|---|---|---|
The Bacillus subtilis open reading frame ysgA encodes the SPOUT methyltransferase RlmP forming 2'- O-methylguanosine at position 2553 in the A-loop of 23S rRNA | Martine Roovers , Geoffray Labar , Philippe Wolff , André Feller , Dany Van Elder , Romuald Soin , Cyril Gueydan , Véronique Kruys , Louis Droogmans | [details] | 35710145 | 10.1261/rna.079131.122 |