Modomics - A Database of RNA Modifications

ID Card:

Full name: tRNA (guanine-N(1)-)-methyltransferase
UniProt: O31741
Alpha Fold Predicted Structure: AF-O31741-F1
Enzyme type: methyltransferase
Position of modification - modification: t:37 -m1G



Protein sequence:

MKIDFLTLFPEMFEGVLGSSILQKAQEKDAVQFQVVNFREYSDNKHNTVDDYPYGGGAGMVLKPQPVFDAVEDLTSKAAAAPRIILVCPQGERFTQKKAEQLAKEEHLLFICGHYEGYDERIREHLVTDEISIGDFVLTGGELPAMMIADSVVRLLPGVLGKEASHIEDSFSTGLLEHPHYTRPADYKGLKVPETLLSGNHAKIEEWRNKESIRRTYLRRPDLLKDHPLTEQQRKWISEWEKE

Comments:





Alpha Fold Predicted Structure:






Clear Selection and Reset Camera

Protein sequence:


Secondary Structure Alphabet

  • G: 3-turn helix (310helix)
  • H: α-helix
  • I: 𝝅-helix (5 - turn helix)
  • T: Hydrogen Bonded Turn
  • B: β-sheet
  • S: Bend
  • C: Coil (residues not present in any of the above conformations)
  • N: Not assigned

Download PDB Structures & DSSP Secondary Structures:

Alpha Fold Pdb Files   AF-O31741-F1.pdb  
Alpha Fold Pdbx/mmCIF Files   AF-O31741-F1.cif  
DSSP Secondary Structures   O31741.dssp  





Publications:

Title Authors Journal Details PubMed Id DOI