Modomics - A Database of RNA Modifications

Full name:	Ribosomal large subunit pseudouridine synthase B
Synonym:	YciL
GI:	1175678
Orf:	yciL, b1269
COG:	COG1187
UniProt:	P37765
Structures:	\| \|
Complex:
Enzyme type:	pseudouridine synthase
Position of modification - modification:	l:2605(2605) - Y

Comments:

The site-specific RluB (formerly YciL) catalyzes the formation of pseudouridine at position 2605 in the stem of helix 93 in Domain V (Peptidyl Transferase Center) of 23S rRNA (pseudourodine at position 2604 is catalyzed by a different multi-site RNA pseudouridine synthase RluC). RluB (but not RluC) belongs to the same subgroup of RNA pseudouridine synthases as E. coli RluE and RluF.

Protein sequence:

MSEKLQKVLARAGHGSRREIESIIEAGRVSVDGKIAKLGDRVEVTPGLKIRIDGHLISVRESAEQICRVLAYYKPEGELCTRNDPEGRPTVFDRLPKLRG
ARWIAVGRLDVNTCGLLLFTTDGELANRLMHPSREVEREYAVRVFGQVDDAKLRDLSRGVQLEDGPAAFKTIKFSGGEGINQWYNVTLTEGRNREVRRLW
EAVGVQVSRLIRVRYGDIPLPKGLPRGGWTELDLAQTNYLRELVELPPETSSKVAVEKDRRRMKANQIRRAVKRHSQVSGGRRSGGRNNNG

Enzymatic activities:

Reaction	Substrate	Type	Position
U:Y	rRNA (r)	LSU/23S/prokaryotic cytosol	2605

Publications:

Title	Authors	Journal	Details	PubMed Id	DOI
Identification and site of action of the remaining four putative pseudouridine synthases in Escherichia coli.	Del Campo M, Kaya Y, Ofengand J	RNA	[details]	11720289	-
Pseudouridines and pseudouridine synthases of the ribosome.	Ofengand J, Malhotra A, Remme J, Gutgsell NS, Del Campo M, Jean-Charles S, Peil L, Kaya Y	Cold Spring Harb Symp Quant Biol	[details]	12762017	-