Full name: Ribosomal large subunit pseudouridine synthase B
Synonym: YciL
GI: 1175678
Orf: yciL, b1269
COG: COG1187
UniProt: P37765
Structures: | |
Complex:
Enzyme type: pseudouridine synthase
Position of modification - modification: l:2605(2605) - Y

Comments:

The site-specific RluB (formerly YciL) catalyzes the formation of pseudouridine at position 2605 in the stem of helix 93 in Domain V (Peptidyl Transferase Center) of 23S rRNA (pseudourodine at position 2604 is catalyzed by a different multi-site RNA pseudouridine synthase RluC). RluB (but not RluC) belongs to the same subgroup of RNA pseudouridine synthases as E. coli RluE and RluF.

Protein sequence:

MSEKLQKVLARAGHGSRREIESIIEAGRVSVDGKIAKLGDRVEVTPGLKIRIDGHLISVRESAEQICRVL AYYKPEGELCTRNDPEGRPTVFDRLPKLRGARWIAVGRLDVNTCGLLLFTTDGELANRLMHPSREVEREY AVRVFGQVDDAKLRDLSRGVQLEDGPAAFKTIKFSGGEGINQWYNVTLTEGRNREVRRLWEAVGVQVSRL IRVRYGDIPLPKGLPRGGWTELDLAQTNYLRELVELPPETSSKVAVEKDRRRMKANQIRRAVKRHSQVSG GRRSGGRNNNG

Enzymatic activities:

Reaction Substrate Type Position
U:Y rRNA (r) LSU/23S/prokaryotic cytosol 2605

Publications:

Title Authors Journal Details PubMed Id DOI
Identification and site of action of the remaining four putative pseudouridine synthases in Escherichia coli. Del Campo M, Kaya Y, Ofengand J RNA [details] 11720289 -
Pseudouridines and pseudouridine synthases of the ribosome. Ofengand J, Malhotra A, Remme J, Gutgsell NS, Del Campo M, Jean-Charles S, Peil L, Kaya Y Cold Spring Harb Symp Quant Biol [details] 12762017 -
Copyright © Genesilico - All rights reserved
If you have any advice or suggestions for corrections or improvements, please contact: Pietro Boccaletto