Full name: Nucleolar protein 58
Synonym: Nop5p
GI: 2833225
Orf: YOR310C
COG: COG1498
UniProt: Q12499
Structures: | |
Complex: C/D RNP

Comments:

Required for pre-18S rRNA processing. May bind microtubules. Interacts with NOP56p and NOP1p. Together with Nop56 and Snu13 makes a core of the C/D RNP complex.

Protein sequence:

MAYVLTETSAGYALLKASDKKIYKSSSLIQDLDSSDKVLKEFKIAAFSKFNSAANALEEANSIIEGKVSS QLEKLLEEIKKDKKSTLIVSETKLANAINKLGLNFNVVSDAVTLDIYRAIKEYLPELLPGMSDNDLSKMS LGLAHSIGRHKLKFSADKVDVMIIQAIALLDDLDKELNTYAMRCKEWYGWHFPELAKIVTDSVAYARIIL TMGIRSKASETDLSEILPEEIEERVKTAAEVSMGTEITQTDLDNINALAEQIVEFAAYREQLSNYLSARM KAIAPNLTQLVGELVGARLIAHSGSLISLAKSPASTIQILGAEKALFRALKTKHDTPKYGLLYHASLVGQ ATGKNKGKIARVLAAKAAVSLRYDALAEDRDDSGDIGLESRAKVENRLSQLEGRDLRTTPKVVREAKKVE MTEARAYNADADTAKAASDSESDSDDEEEEKKEKKEKKRKRDDDEDSKDSKKAKKEKKDKKEKKEKKEKK EKKEKKEKKEKKSKKEKKEKK

Publications:

Title Authors Journal Details PubMed Id DOI
Nop5p is a small nucleolar ribonucleoprotein component required for pre-18 S rRNA processing in yeast. Wu P, Brockenbrough JS, Metcalfe AC, Chen S, Aris JP J Biol Chem [details] 9632712 -
Nucleolar KKE/D repeat proteins Nop56p and Nop58p interact with Nop1p and are required for ribosome biogenesis. Gautier T, Berges T, Tollervey D, Hurt E Mol Cell Biol [details] 9372940 -
Box C/D snoRNP catalysed methylation is aided by additional pre-rRNA base-pairing. van Nues RW, Granneman S, Kudla G, Sloan KE, Chicken M, Tollervey D, Watkins NJ EMBO J [details] 21556049 -

Links:

_SGD_
_PubMed_
Copyright © Genesilico - All rights reserved
If you have any advice or suggestions for corrections or improvements, please contact: Pietro Boccaletto