Full name: Nucleolar protein 56
Synonym: Sik1
GI: 2833223
Orf: YLR197W
COG: COG1498
UniProt: Q12460
Structures: | |
Complex: C/D RNP

Comments:

Together with Nop58, Snu13 and fibrillarine, they constitute the core of the snoRNA-dependent 2’-O-ribose methyltransferase machinery of RNA.

Protein sequence:

MAPIEYLLFEEPTGYAVFKVKLQQDDIGSRLKEVQEQINDFGAFTKLIELVSFAPFKGAAEALENANDIS EGLVSESLKAILDLNLPKASSKKKNITLAISDKNLGPSIKEEFPYVDCISNELAQDLIRGVRLHGEKLFK GLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALLDQLDKDINTFAMRVKEWYGWHFPELAKLV PDNYTFAKLVLFIKDKASLNDDSLHDLAALLNEDSGIAQRVIDNARISMGQDISETDMENVCVFAQRVAS LADYRRQLYDYLCEKMHTVAPNLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKG NTPKYGLIYHSGFISKASAKNKGRISRYLANKCSMASRIDNYSEEPSNVFGSVLKKQVEQRLEFYNTGKP TLKNELAIQEAMELYNKDKPAAEVEETKEKESSKKRKLEDDDEEKKEKKEKKSKKEKKEKKEKKDKKEKK DKKEKKDKKKKSKD

Publications:

Title Authors Journal Details PubMed Id DOI
Nucleolar KKE/D repeat proteins Nop56p and Nop58p interact with Nop1p and are required for ribosome biogenesis. Gautier T, Berges T, Tollervey D, Hurt E Mol Cell Biol [details] 9372940 -
Box C/D snoRNP catalysed methylation is aided by additional pre-rRNA base-pairing. van Nues RW, Granneman S, Kudla G, Sloan KE, Chicken M, Tollervey D, Watkins NJ EMBO J [details] 21556049 -

Links:

_SGD_
_PubMed_
_Wikipedia - Small nucleolar RNA_
Copyright © Genesilico - All rights reserved
If you have any advice or suggestions for corrections or improvements, please contact: Pietro Boccaletto