Full name: 13 kDa ribonucleoprotein-associated protein
Synonym: YEL026W
GI: 731411
Orf: YEL026W
COG: COG1358
UniProt: P39990
Structures: | 2ALE |
Complex: C/D RNP

Comments:

Snu13 protein together with Nop56 and Nop58 makes the core of C/D RNP complex in yeast. It is a homologue of mammalian 15.5kD protein and Archaea L7Ae.

Protein sequence:

MSAPNPKAFPLADAALTQQILDVVQQAANLRQLKKGANEATKTLNRGISEFIIMAADCEPIEILLHLPLL CEDKNVPYVFVPSRVALGRACGVSRPVIAASITTNDASAIKTQIYAVKDKIETLLI

Publications:

Title Authors Journal Details PubMed Id DOI
A structural, phylogenetic, and functional study of 15.5-kD/Snu13 protein binding on U3 small nucleolar RNA. Marmier-Gourrier N, Clery A, Senty-Segault V, Charpentier B, Schlotter F, Leclerc F, Fournier R, Branlant C RNA [details] 12810916 -
Analysis of Snu13p mutations reveals differential interactions with the U4 snRNA and U3 snoRNA. Dobbyn HC, O'Keefe RT RNA [details] 14730029 -

Links:

_SGD_
_PubMed_
Copyright © Genesilico - All rights reserved
If you have any advice or suggestions for corrections or improvements, please contact: Pietro Boccaletto