Modomics - A Database of RNA Modifications

ID Card:

Full name: Ribosomal RNA large subunit methyltransferase Q
Synonym: ywdB
UniProt: P39610
Enzyme type:
Position of modification - modification: :2574(None) - m7G
Level of experimental evidence: 2
Level of experimental reliability: 2



Protein sequence:

MSMHKALTIAGSDSSGGAGIQADLKTFQEKNVYGMTALTVIVAMDPNNSWNHQVFPIDTDTIRAQLATITDGIGVDAMKTGMLPTVDIIELAAKTIKEKQLKNVVIDPVMVCKGANEVLYPEHAQALREQLAPLATVITPNLFEASQLSGMDELKTVDDMIEAAKKIHALGAQYVVITGGGKLKHEKAVDVLYDGETAEVLESEMIDTPYTHGAGCTFSAAVTAELAKGAEVKEAIYAAKEFITAAIKESFPLNQYVGPTKHSALRLNQQS

Comments:

RlmQ methylates position 2574 of the 23S rRNA and not ribosomal 50S or 70S particles, suggesting that modification occurs in the early steps of ribosome biogenesis.




Reaction Substrate SubstrateType Position (Anti)Codon Modified (Anti)Codon Amino Acid Change Transcript Name Transcript Region Cellular Localization References
G:m7G rRNA (r) rRNA/rRNA/prokaryotic cytosol 2574



Publications:

Title Authors Journal Details PubMed Id DOI
The <i>Bacillus subtilis ywbD</i> gene encodes RlmQ, the 23S rRNA methyltransferase forming m<sup>7</sup>G2574 in the A-site of the peptidyl transferase center. Wolff P; Labar G; Lechner A; Van Elder D; Soin R; Gueydan C; Kruys V; Droogmans L; Roovers M RNA [details] 38071475 10.1261/rna.079853.123