Modomics - A Database of RNA Modifications

Full name:	tRNA (guanine(46)-N7)-methyltransferase
Synonym:	YggH
GI:	67473592
Orf:	b2960
COG:	COG0220
UniProt:	P0A8I5
Structures:	\| 3DXX \| 3DXY \| 3DXZ \|
Complex:
Enzyme type:	methyltransferase
Position of modification - modification:	t:46 - m7G

Comments:

AdoMet is the methyl group donor.

Protein sequence:

MKNDVISPEFDENGRPLRRIRSFVRRQGRLTKGQEHALENYWPVMGVEFSEDMLDFPALFGREAPVTLEIGFGMGASLVAMAKDRPEQDFLGIEVHSPGV
GACLASAHEEGLSNLRVMCHDAVEVLHKMIPDNSLRMVQLFFPDPWHKARHNKRRIVQVPFAELVKSKLQLGGVFHMATDWEPYAEHMLEVMSSIDGYKN
LSESNDYVPRPASRPVTKFEQRGHRLGHGVWDLMFERVK

Enzymatic activities:

Reaction	Substrate	Type	Position
G:m7G	tRNA (t)	Ala/UGC/prokaryotic cytosol	46
G:m7G	tRNA (t)	Ala/GGC/prokaryotic cytosol	46
G:m7G	tRNA (t)	Arg/ACG/prokaryotic cytosol	46
G:m7G	tRNA (t)	Arg/CCG/prokaryotic cytosol	46
G:m7G	tRNA (t)	Asn/GUU/prokaryotic cytosol	46
G:m7G	tRNA (t)	Asp/GUC/prokaryotic cytosol	46
G:m7G	tRNA (t)	Gly/GCC/prokaryotic cytosol	46
G:m7G	tRNA (t)	His/GUG/prokaryotic cytosol	46
G:m7G	tRNA (t)	Ile/GAU/prokaryotic cytosol	46
G:m7G	tRNA (t)	Ile/CAU/prokaryotic cytosol	46
G:m7G	tRNA (t)	Lys/SUU/prokaryotic cytosol	46
G:m7G	tRNA (t)	Met/CAU/prokaryotic cytosol	46
G:m7G	tRNA (t)	Phe/GAA/prokaryotic cytosol	46
G:m7G	tRNA (t)	Thr/GGU/prokaryotic cytosol	46
G:m7G	tRNA (t)	Trp/CCA/prokaryotic cytosol	46
G:m7G	tRNA (t)	Val/UAC/prokaryotic cytosol	46
G:m7G	tRNA (t)	Val/GAC/prokaryotic cytosol	46
G:m7G	tRNA (t)		46

Publications:

Title	Authors	Journal	Details	PubMed Id	DOI
The yggH gene of Escherichia coli encodes a tRNA (m7G46) methyltransferase.	De Bie LG, Roovers M, Oudjama Y, Wattiez R, Tricot C, Stalon V, Droogmans L, Bujnicki JM	J Bacteriol	[details]	12730187	-
Sequence-structure-function relationships of a tRNA (m7G46) methyltransferase studied by homology modeling and site-directed mutagenesis.	Purta E, van Vliet F, Tricot C, De Bie LG, Feder M, Skowronek K, Droogmans L, Bujnicki JM	Proteins	[details]	15789416	-