| Full name: | tRNA (cytidine/uridine(34)-2'-O)-methyltransferase |
|---|---|
| Synonym: | PA14_67710 |
| UniProt: | A0A2X2DB37 |
| Enzyme type: | |
| Level of experimental evidence: | 3 |
| Level of experimental reliability: | 3 |
MFHVILFQPEIPPNTGNIIRLCANAGCSLHLIEPLGFELDDKRLRRAGLDYHEYASVRRYPDLQSCLEALGQPRLFAFTTKGSRAFHEVAYQRDDAFLFGPESRGLPENVRNALPTDRRLRLPMREGCRSLNLSNTVAVTVYEAWRQLGFAMD
None
| Title | Authors | Journal | Details | ||
|---|---|---|---|---|---|
| Methylation at position 32 of tRNA catalyzed by TrmJ alters oxidative stress response in Pseudomonas aeruginosa. | Jaroensuk J; Atichartpongkul S; Chionh YH; Wong YH; Liew CW; McBee ME; Thongdee N; Prestwich EG; DeMott MS; Mongkolsuk S; Dedon PC; Lescar J; Fuangthong M | Nucleic Acids Res | [details] | 27683218 | - |
| Widespread 3' UTR splicing regulates expression of oncogene transcripts through multiple mechanisms. | Riley JJ; Alexandru-Crivac CN; Bryce-Smith S; Wilson SA; Sudbery IM | Nucleic Acids Res | [details] | 40716781 | 10.1093/nar/gkaf700 |