Full name: tRNA (guanosine(37)-N1)-methyltransferase
Synonym: JW2588
GI: 67473571
Orf: b2607
COG: COG0336
UniProt: P0A873
Structures: | 1P9P |
Complex:
Enzyme type: methyltransferase
Position of modification - modification: t:37 - m1G

Comments:

AdoMet is the methyl group donor. SPOUT superfamily.

Protein sequence:

MWIGIISLFPEMFRAITDYGVTGRAVKNGLLSIQSWSPRDFTHDRHRTVDDRPYGGGPGMLMMVQPLRDA IHAAKAAAGEGAKVIYLSPQGRKLDQAGVSELATNQKLILVCGRYEGIDERVIQTEIDEEWSIGDYVLSG GELPAMTLIDSVSRFIPGVLGHEASATEDSFAEGLLDCPHYTRPEVLEGMEVPPVLLSGNHAEIRRWRLK QSLGRTWLRRPELLENLALTEEQARLLAEFKTEHAQQQHKHDGMA

Enzymatic activities:

Reaction Substrate Type Position
G:m1G tRNA (t) Leu/CAG/prokaryotic cytosol 37
G:m1G tRNA (t) Leu/GAG/prokaryotic cytosol 37
G:m1G tRNA (t) Leu/UAGd/prokaryotic cytosol 37
G:m1G tRNA (t) Pro/CGGd/prokaryotic cytosol 37
G:m1G tRNA (t) Pro/GGGd/prokaryotic cytosol 37
G:m1G tRNA (t) Pro/UGGd/prokaryotic cytosol 37
G:m1G tRNA (t) Arg/CCG/prokaryotic cytosol 37

Publications:

Title Authors Journal Details PubMed Id DOI
The structural gene (trmD) for the tRNA(m1G)methyltransferase is part of a four polypeptide operon in Escherichia coli K-12. Bystrom AS, Bjork GR Mol Gen Genet [details] 6298574 -
Insights into catalysis by a knotted TrmD tRNA methyltransferase. Elkins PA, Watts JM, Zalacain M, van Thiel A, Vitazka PR, Redlak M, Andraos-Selim C, Rastinejad F, Holmes WM J Mol Biol [details] 14583191 -
Control of catalytic cycle by a pair of analogous tRNA modification enzymes. Christian T, Lahoud G, Liu C, Hou YM J Mol Biol [details] 20452364 -
Copyright © Genesilico - All rights reserved
If you have any advice or suggestions for corrections or improvements, please contact: Pietro Boccaletto