Full name: tRNA modification GTPase MSS1
Synonym: Pet53
GI: 1709142
Orf: YMR023C
COG: COG0486
UniProt: P32559
Structures: | |
Complex: Mss1/Mto1
Enzyme type: GTPase
Position of modification - modification:

Comments:

Yeast mitochondrial homolog of bacterial GTPase MnmE. Makes a stable complex with Mto1p. Does not work on cytoplasmic tRNAs.

Protein sequence:

MNSASFLQSRLISRSFLVRRSLKRYSGLAKPYTFQQPTIYALSTPANQTSAIAIIRISGTHAKYIYNRLV DSSTVPPIRKAILRNIYSPSSCSVKPHDQKESKILLDTSLLLYFQAPYSFTGEDVLELHVHGGKAVVNSI LKAIGSLHDRSSGKDIRFALPGDFSRRAFQNGKFDLTQLEGIKDLIDSETESQRRSALSSFNGDNKILFE NWRETIIENMAQLTAIIDFADDNSQEIQNTDEIFHNVEKNIICLRDQIVTFMQKVEKSTILQNGIKLVLL GAPNVGKSSLVNSLTNDDISIVSDIPGTTRDSIDAMINVNGYKVIICDTAGIREKSSDKIEMLGIDRAKK KSVQSDLCLFIVDPTDLSKLLPEDILAHLSSKTFGNKRIIIVVNKSDLVSDDEMTKVLNKLQTRLGSKYP ILSVSCKTKEGIESLISTLTSNFESLSQSSADASPVIVSKRVSEILKNDVLYGLEEFFKSKDFHNDIVLA TENLRYASDGIAKITGQAIGIEEILDSVFSKFCIGK

Enzymatic activities:

Reaction Substrate Type Position
s2U:cmnm5s2U tRNA (t)   34
U:cmnm5U tRNA (t) 34

Publications:

Title Authors Journal Details PubMed Id DOI
MSS1, a nuclear-encoded mitochondrial GTPase involved in the expression of COX1 subunit of cytochrome c oxidase. Decoster E, Vassal A, Faye G J Mol Biol [details] 8392589 -
Mitochondria-specific RNA-modifying enzymes responsible for the biosynthesis of the wobble base in mitochondrial tRNAs. Implications for the molecular pathogenesis of human mitochondrial diseases. Umeda N, Suzuki T, Yukawa M, Ohya Y, Shindo H, Watanabe K, Suzuki T J Biol Chem [details] 15509579 -

Links:

_SGD_
_PubMed_
Copyright © Genesilico - All rights reserved
If you have any advice or suggestions for corrections or improvements, please contact: Pietro Boccaletto