Modomics - A Database of RNA Modifications

ID Card:

Full name: tRNA-uridine aminocarboxypropyltransferase 1
UniProt: Q8N5C7
Enzyme type:
Position of modification - modification: t:None - acp3U
Level of experimental evidence: 2
Level of experimental reliability: 2



Protein sequence:

MSLNPPIFLKRSEENSSKFVETKQSQTTSIASEDPLQNLCLASQEVLQKAQQSGRSKCLKCGGSRMFYCYTCYVPVENVPIEQIPLVKLPLKIDIIKHPNETDGKSTAIHAKLLAPEFVNIYTYPCIPEYEEKDHEVALIFPGPQSISIKDISFHLQKRIQNNVRGKNDDPDKPSFKRKRTEEQEFCDLNDSKCKGTTLKKIIFIDSTWNQTNKIFTDERLQGLLQVELKTRKTCFWRHQKGKPDTFLSTIEAIYYFLVDYHTDILKEKYRGQYDNLLFFYSFMYQLIKNAKCSGDKETGKLTH

Comments:

DTWD1 is responsible for the formation of acp3U at position 20 of tRNAs. In human cells, double knockout of DTWD1 and DTWD2 (acp3U at U20a) causes slow growth, indicating that acp3U is also physiologically important in mammals




Reaction Substrate SubstrateType Position (Anti)Codon Modified (Anti)Codon Amino Acid Change Transcript Name Transcript Region Cellular Localization References
U:acp3U tRNA (t) tRNA/tRNA/eukaryotic nucleoplasm 20



Publications:

Title Authors Journal Details PubMed Id DOI
Biogenesis and functions of aminocarboxypropyluridine in tRNA. Takakura M; Ishiguro K; Akichika S; Miyauchi K; Suzuki T Nat Commun [details] 31804502 10.1038/s41467-019-13525-3