Modomics - A Database of RNA Modifications

ID Card:

Full name: 16S rRNA aminocarboxypropyltransferase
UniProt: E1QU22
Structures: | 5APG |
Enzyme type:
Level of experimental evidence: 3
Level of experimental reliability: 3


PDB Structures:


5APG

Structure Description:

Title:
Classification:
Technique:

Abstract of the PDB Structure's related Publication:



Download RCSB-PDB Structures:

Pdb Files   5APG.pdb  
Pdbx/mmCIF Files   5APG.cif  


Protein sequence:

MIPRVFIYRLPQDDPRKNTAIKLVRFGFAQLVDSIKALPSGSIILDPTVKTPLTPSDRVIAESRGLSLIDCSWKRAVDVHTKFIRGKFIRRRLPLLIAANPTHYGKPYILSTIEAVAAALYIMGFKDEAMEVLRLYKWGPNFIIINQKYLERYAAGDLSPERELLGVDDVDNGLEQLMRVLTNGD

Comments:

Aminocarboxypropyltransferase that catalyzes the aminocarboxypropyl transfer on pseudouridine corresponding to position 914 in M.jannaschii 16S rRNA. It constitutes the last step in biosynthesis of the hypermodified N1-methyl-N3-(3-amino-3-carboxypropyl) pseudouridine (m1acp3-Y)







Publications:

Title Authors Journal Details PubMed Id DOI
Ribosome biogenesis factor Tsr3 is the aminocarboxypropyl transferase responsible for 18S rRNA hypermodification in yeast and humans Britta Meyer 1, Jan Philip Wurm 2, Sunny Sharma 3, Carina Immer 2, Denys Pogoryelov 4, Peter Kötter 1, Denis L J Lafontaine 3, Jens Wöhnert 5, Karl-Dieter Entian [details] 27084949 10.1093/nar/gkw244