Full name: tRNA (guanine-N(1)-)-methyltransferase
Synonym: O0926
GI: 74645051
Orf: YOL093W
COG: COG2419
UniProt: Q12400
Structures: | 4JWJ |
Complex:
Enzyme type: methyltransferase
Position of modification - modification: t:9 - m1G

Comments:

Monomeric cytoplasmic enzyme. AdoMet is the methyl group donor. Bears no detectable resemblance to the yeast m1G37 methyltransferase, Trm5, or its orthologs. Homologs are found widely only in eukaryotes and archaea, with multiple homologs in several metazoans (at least three in humans). Not essential, yet it plays a role in translation termination efficiency. The substrate specificity of this enzyme is broader than expected from modification status of tRNA obtained from wild type S. cerevisiae (additional substrates were found via in vitro experiments and studies with overexpressed enzyme). Sequence or structure determinants of specificity are unknown.

Protein sequence:

MSNDEINQNEEKVKRTPPLPPVPEGMSKKQWKKMCKRQRWEENKAKYNAERRVKKKRLRHERSAKIQEYI DRGEEVPQELIREPRINVNQTDSGIEIILDCSFDELMNDKEIVSLSNQVTRAYSANRRANHFAEIKVAPF DKRLKQRFETTLKNTNYENWNHFKFLPDDKIMFGDEHISKDKIVYLTADTEEKLEKLEPGMRYIVGGIVD KNRYKELCLKKAQKMGIPTRRLPIDEYINLEGRRVLTTTHVVQLMLKYFDDHNWKNAFESVLPPRKLDAE AKSASSSPAPKDT

Enzymatic activities:

Reaction Substrate Type Position
G:m1G tRNA (t) Ala/IGC/prokaryotic cytosol 9
G:m1G tRNA (t) Arg/UCU/cytosolic 9
G:m1G tRNA (t) Arg/ICG/prokaryotic cytosol 9
G:m1G tRNA (t) Gly/GCC/prokaryotic cytosol 9
G:m1G tRNA (t) Ile/IAU/prokaryotic cytosol 9
G:m1G tRNA (t) Pro/UGG/prokaryotic cytosol 9
G:m1G tRNA (t) Trp/CCA/prokaryotic cytosol 9
G:m1G tRNA (t) Val/IAC/prokaryotic cytosol 9
G:m1G tRNA (t) Lys/CUU/prokaryotic cytosol 9
G:m1G tRNA (t) Ini/CAU/cytosolic 9
G:m1G tRNA (t) Val/UAC/cytosolic 9
G:m1G tRNA (t) Cys/GCA/cytosolic 9
G:m1G tRNA (t) Thr/AGU/cytosolic 9
G:m1G tRNA (t) Gly/CCC/cytosolic 9
G:m1G tRNA (t) Thr/CGU/cytosolic 9
G:m1G tRNA (t) Lys/CUU/cytosolic 9

Publications:

Title Authors Journal Details PubMed Id DOI
Identification of the yeast gene encoding the tRNA m1G methyltransferase responsible for modification at position 9. Jackman JE, Montange RK, Malik HS, Phizicky EM RNA [details] 12702816 -
Variants in SUP45 and TRM10 underlie natural variation in translation termination efficiency in Saccharomyces cerevisiae. Torabi N, Kruglyak L PLoS Genet [details] 21829385 -
Unexpected expansion of tRNA substrate recognition by the yeast m1G9 methyltransferase Trm10. Swinehart WE, Henderson JC, Jackman JE... RNA [details] 23793893 -
Crystal structure of tRNA m1G9 methyltransferase Trm10: insight into the catalytic mechanism and recognition of tRNA substrate Shao Z, Yan W, Peng J, Zuo X, Zou Y, Li F, Gong D, Ma R, Wu J, Shi Y, Zhang Z, Teng M, Li X, Gong Q Nucleic Acids Res. [details] 24081582 10.1093/nar/gkt869

Links:

_PubMed_
Copyright © Genesilico - All rights reserved
If you have any advice or suggestions for corrections or improvements, please contact: Pietro Boccaletto