Modomics - A Database of RNA Modifications

ID Card:

Full name: tRNA uridine(34) hydroxylase
Synonym: yceA
UniProt: P24188
Enzyme type:
Position of modification - modification: t:None - ho5U
Level of experimental evidence: 2
Level of experimental reliability: 2



Protein sequence:

MPVLHNRISNDALKAKMLAESEPRTTISFYKYFHIADPKATRDALYQLFTALNVFGRVYLAHEGINAQISVPASNVETFRAQLYAFDPALEGLRLNIALDDDGKSFWVLRMKVRDRIVADGIDDPHFDASNVGEYLQAAEVNAMLDDPDALFIDMRNHYEYEVGHFENALEIPADTFREQLPKAVEMMQAHKDKKIVMYCTGGIRCEKASAWMKHNGFNKVWHIEGGIIEYARKAREQGLPVRFIGKNFVFDERMGERISDEIIAHCHQCGAPCDSHTNCKNDGCHLLFIQCPVCAEKYKGCCSEICCEESALPPEEQRRRRAGRENGNKIFNKSRGRLNTTLCIPDPTE

Comments:

Catalyzes oxygen-dependent 5-hydroxyuridine (ho5U) modification at position 34 in tRNAs, the first step in 5-carboxymethoxyuridine (cmo5U) biosynthesis. May be part of an alternate pathway, which is able to bypass cmo5U biogenesis in a subset of tRNAs under aerobic conditions




Reaction Substrate SubstrateType Position (Anti)Codon Modified (Anti)Codon Amino Acid Change Transcript Name Transcript Region Cellular Localization References
U:ho5U tRNA (t) tRNA/tRNA/prokaryotic cytosol 34



Publications:

Title Authors Journal Details PubMed Id DOI
Dual pathways of tRNA hydroxylation ensure efficient translation by expanding decoding capability. Sakai Y; Kimura S; Suzuki T Nat Commun [details] 31253794 10.1038/s41467-019-10750-8