ID Card:
    
        
            
                | Full name:  | 
                tRNA uridine(34) hydroxylase | 
            
            
            
                | Synonym:  | 
                yceA | 
            
            
            
            
            
            
            
            
                | UniProt:  | 
                P24188 | 
            
            
            
            
            
            
            
                | Enzyme type:  | 
                 | 
            
            
                
                    |  Position of modification - modification:  | 
                    
                        
                            t:None - ho5U  
                            
                         | 
                
                    
            
            
            
            
                | Level of experimental evidence:  | 
                2 | 
            
            
            
            
                | Level of experimental reliability:  | 
                2 | 
            
            
        
      
    
  
Protein sequence:
        
        
            
                
                    MPVLHNRISNDALKAKMLAESEPRTTISFYKYFHIADPKATRDALYQLFTALNVFGRVYLAHEGINAQISVPASNVETFRAQLYAFDPALEGLRLNIALDDDGKSFWVLRMKVRDRIVADGIDDPHFDASNVGEYLQAAEVNAMLDDPDALFIDMRNHYEYEVGHFENALEIPADTFREQLPKAVEMMQAHKDKKIVMYCTGGIRCEKASAWMKHNGFNKVWHIEGGIIEYARKAREQGLPVRFIGKNFVFDERMGERISDEIIAHCHQCGAPCDSHTNCKNDGCHLLFIQCPVCAEKYKGCCSEICCEESALPPEEQRRRRAGRENGNKIFNKSRGRLNTTLCIPDPTE
                
                
             
         
        
Comments: 
Catalyzes oxygen-dependent 5-hydroxyuridine (ho5U) modification at position 34 in tRNAs, the first step in 5-carboxymethoxyuridine (cmo5U) biosynthesis. May be part of an alternate pathway, which is able to bypass cmo5U biogenesis in a subset of tRNAs under aerobic conditions
    
        
            
            
                | Reaction | 
                Substrate | 
                SubstrateType | 
                Position | 
                (Anti)Codon | 
                Modified (Anti)Codon | 
                Amino Acid Change | 
                Transcript Name | 
                Transcript Region | 
                Cellular Localization | 
                
               
                References | 
            
            
            
            
            
                | 
                    
                    
                    
                        U:ho5U
                    
                 | 
                
                tRNA (t) | 
                
                
                tRNA/tRNA/prokaryotic cytosol | 
                
                34 | 
                  | 
                  | 
                  | 
                  | 
                  | 
                  | 
                
                
                 | 
            
            
            
        
    
Publications:
    
    
        | Title | 
        Authors | 
        Journal | 
        Details | 
        PubMed Id | 
        DOI | 
    
    
    
    
    
        | Dual pathways of tRNA hydroxylation ensure efficient translation by expanding decoding capability. | 
        Sakai Y; Kimura S; Suzuki T | 
        Nat Commun | 
        
            [details]
         | 
        
            31253794
            
         | 
        
              10.1038/s41467-019-10750-8 
            
         |