Modomics - A Database of RNA Modifications

Full name:	Ribosomal RNA large subunit methyltransferase I
Synonym:	yccW, JW5898
GI:	13432272
Orf:	b0967
COG:	COG1092
UniProt:	P75876
Structures:	\| 3C0K \|
Complex:
Enzyme type:	methyltransferase
Position of modification - modification:	l:1962(1962) - m5C

Comments:

RlmI specifically methylates the C5-residue of conserved cytosine 1962 (m5C), located in position just precedding hairpin 71 of domain IV in 23S rRNA. In vitro, it works on naked 23S rRNA isolated from the yccW knockout strain, and not in assembled 50S subunits or ribosomes. The methyl donor group is AdoMet. The RlmI molecule comprises three domains: the N-terminal PUA domain; the central domain, which resembles a domain previously found in RNA:5-methyluridine MTases, and the C-terminal catalytic domain, which contains the AdoMet-binding site. The central and C-terminal domains are linked by a beta-hairpin structure that has previously been observed in several MTases acting on nucleic acids or proteins. On evolutionary point of view, RlmI is similar to known m5U (5-methyluridine) RNA methyltransferases.

Protein sequence:

MSVRLVLAKGREKSLLRRHPWVFSGAVARMEGKASLGETIDIVDHQGKWLARGAYSPASQIRARVWTFDPSESIDIAFFSRRLQQAQKWRDWLAQKDGLD
SYRLIAGESDGLPGITIDRFGNFLVLQLLSAGAEYQRAALISALQTLYPECSIYDRSDVAVRKKEGMELTQGPVTGELPPALLPIEEHGMKLLVDIQHGH
KTGYYLDQRDSRLATRRYVENKRVLNCFSYTGGFAVSALMGGCSQVVSVDTSQEALDIARQNVELNKLDLSKAEFVRDDVFKLLRTYRDRGEKFDVIVMD
PPKFVENKSQLMGACRGYKDINMLAIQLLNEGGILLTFSCSGLMTSDLFQKIIADAAIDAGRDVQFIEQFRQAADHPVIATYPEGLYLKGFACRVM

Enzymatic activities:

Reaction	Substrate	Type	Position
C:m5C	rRNA (r)	LSU/23S/prokaryotic cytosol	1962

Publications:

Title	Authors	Journal	Details	PubMed Id	DOI
YccW is the m5C methyltransferase specific for 23S rRNA nucleotide 1962.	Purta E, O'Connor M, Bujnicki JM, Douthwaite S	J Mol Biol	[details]	18786544	-
Crystal structure of the Escherichia coli 23S rRNA:m5C methyltransferase RlmI (YccW) reveals evolutionary links between RNA modification enzymes.	Sunita S, Tkaczuk KL, Purta E, Kasprzak JM, Douthwaite S, Bujnicki JM, Sivaraman J	J Mol Biol	[details]	18789337	-
5-methylcytosine in RNA: detection, enzymatic formation and biological functions.	Motorin Y, Lyko F, Helm M	Nucleic Acids Res	[details]	20007150	-