Modomics - A Database of RNA Modifications

Full name:	Ribosomal RNA large subunit methyltransferase J
Synonym:	yhiR
GI:	586675
Orf:	b3499, JW3466
COG:	COG2961
UniProt:	P37634
Structures:	\| 4BLW \| 4BLV \| 4BLU \|
Complex:
Enzyme type:	methyltransferase
Position of modification - modification:	l:2030(2030) - m6A

Comments:

SAM-dependent MTase. The enzyme is neither essential for ribosome assembly nor for function. The substrate preference in vitro is deproteinized 23S rRNA. Modified residue m6A2030 is located in helix 72, close the peptidyltransferase center of Domain IV and the elongation factor binding site of Domain II in the folded 3D architecture of the ribosome. Orthologs are found mostly in proteobacteria. A possible role is stabilization of local tertiary structure of the ribosome. M6A exist also at position 1618 where it is introduced by a related MTase RlmF(UbiN) and of course at the conserved m6,2A1518, 1519 of 16S rRNA (introduced by RsmA/KsgA).

Protein sequence:

MLSYRHSFHAGNHADVLKHTVQSLIIESLKEKDKPFLYLDTHAGAGRYQLGSEHAERTGEYLEGIARIWQQDDLPAELEAYINVVKHFNRSGQLRYYPGS
PLIARLLLREQDSLQLTELHPSDYPLLRSEFQKDSRARVEKADGFQQLKAKLPPVSRRGLILIDPPYEMKTDYQAVVSGIAEGYKRFATGIYALWYPVVL
RQQIKRMIHDLEATGIRKILQIELAVLPDSDRRGMTASGMIVINPPWKLEQQMNNVLPWLHSKLVPAGTGHATVSWIVPE

Enzymatic activities:

Reaction	Substrate	Type	Position
A:m6A	rRNA (r)	LSU/23S/prokaryotic cytosol	2030

Publications:

Title	Authors	Journal	Details	PubMed Id	DOI
The last rRNA methyltransferase of E. coli revealed: the yhiR gene encodes adenine-N6 methyltransferase specific for modification of A2030 of 23S ribosomal RNA.	Golovina AY, Dzama MM, Osterman IA, Sergiev PV, Serebryakova MV, Bogdanov AA, Dontsova OA...	RNA	[details]	22847818	-
Structural and functional insights into the molecular mechanism of rRNA m6A methyltransferase RlmJ.	Punekar AS, Liljeruhm J, Shepherd TR, Forster AC, Selmer M...	Nucleic Acids Res	[details]	23945937	-

Links:

_PubMed_
_EcoCyc_

_PubMed_

_EcoCyc_