| Title: | |
|---|---|
| Classification: | |
| Technique: | |
| Pdb Files | 1EIZ.pdb   1EJ0.pdb   | 
| Pdbx/mmCIF Files | 1EIZ.cif   1EJ0.cif   | 
MTGKKRSASSSRWLQEHFSDKYVQQAQKKGLRSRAWFKLDEIQQSDKLFKPGMTVVDLGAAPGGWSQYVVTQIGGKGRIIACDLLPMDPIVGVDFLQGDFRDELVMKALLERVGDSKVQVVMSDMAPNMSGTPAVDIPRAMYLVELALEMCRDVLAPGGSFVVKVFQGEGFDEYLREIRSLFTKVKVRKPDSSRARSREVYIVATGRKP
Substrate analysis showed that RlmE (formerly FtsJ, RrmJ) methylates the 2′-O ribose of the universally conserved U2552 in the so-called A-loop (hairpin 92) of the Peptidyl Transferase Center (domain V) of 23S rRNA. E. coli RlmE is active only on the ribosome and the 50 S ribosomal subunit, but is inactive on free rRNA. AdoMet is the methyl group donor. The enzyme possess a TRAM domain. The homologous S.cerevisiae mitochondrial enzyme is Mrm2. In cytoplasmic large subunit rRNA, the equivalent Um2921 (2552 in E. coli numbering) is catalyzed by C/D box RNP, using snR52 as guide-RNA.
| Reaction | Substrate | SubstrateType | Position | (Anti)Codon | Modified (Anti)Codon | Amino Acid Change | Transcript Name | Transcript Region | Cellular Localization | References | 
|---|---|---|---|---|---|---|---|---|---|---|
| U:Um | RNA | rRNA | 2552 | LSU-23S | Prokaryotic Cytosol | 15375145    | 
| Title | Authors | Journal | Details | ||
|---|---|---|---|---|---|
| Substrate binding analysis of the 23S rRNA methyltransferase RrmJ. | Hager J, Staker BL, Jakob U | J Bacteriol | [details] | 15375145 | - | 
| The FtsJ/RrmJ heat shock protein of Escherichia coli is a 23 S ribosomal RNA methyltransferase. | Caldas T, Binet E, Bouloc P, Costa A, Desgres J, Richarme G | J Biol Chem | [details] | 10748051 | - | 
| RNA methylation under heat shock control. | Bugl H, Fauman EB, Staker BL, Zheng F, Kushner SR, Saper MA, Bardwell JC, Jakob U | Mol Cell | [details] | 10983982 | - | 
| Active site in RrmJ, a heat shock-induced methyltransferase. | Hager J, Staker BL, Bugl H, Jakob U | J Biol Chem | [details] | 12181314 | - | 
| Molecular phylogenetics of the RrmJ/fibrillarin superfamily of ribose 2'-O-methyltransferases. | Feder M, Pas J, Wyrwicz LS, Bujnicki JM | Gene | [details] | 12527203 | - |