ID Card:

Full name: Ribosomal RNA large subunit methyltransferase E
Synonym: RrmJ, Ftsj, MrsF, JW3146
GI: 83287970
Orf: b3179, c3936, z4541, Ecs4058
COG: COG0293
UniProt: P0C0R7
Structures: | 1EIZ | 1EJO |
Enzyme type: methyltransferase
Position of modification - modification: l:2552(2552) - Um


PDB Structures:


1EIZ

Structure Description:

Title:
Classification:
Technique:

Abstract of the PDB Structure's related Publication:

Structural, biochemical, and genetic techniques were applied to investigate the function of FtsJ, a recently identified heat shock protein. FtsJ is well conserved, from bacteria to humans. The 1.5 A crystal structure of FtsJ in complex with its cofactor S-adenosylmethionine revealed that FtsJ has a methyltransferase fold. The molecular surface of FtsJ exposes a putative nucleic acid binding groove composed of highly conserved, positively charged residues. Substrate analysis showed that FtsJ methylates 23S rRNA within 50S ribosomal subunits in vitro and in vivo. Null mutations in ftsJ show a dramatically altered ribosome profile, a severe growth disadvantage, and a temperature-sensitive phenotype. Our results reveal an unexpected link between the heat shock response and RNA metabolism.

Download RCSB-PDB Structures:

Pdb Files   1EIZ.pdb   1EJ0.pdb  
Pdbx/mmCIF Files   1EIZ.cif   1EJ0.cif  


Protein sequence:

MTGKKRSASSSRWLQEHFSDKYVQQAQKKGLRSRAWFKLDEIQQSDKLFKPGMTVVDLGAAPGGWSQYVVTQIGGKGRIIACDLLPMDPIVGVDFLQGDFRDELVMKALLERVGDSKVQVVMSDMAPNMSGTPAVDIPRAMYLVELALEMCRDVLAPGGSFVVKVFQGEGFDEYLREIRSLFTKVKVRKPDSSRARSREVYIVATGRKP

Comments:

Substrate analysis showed that RlmE (formerly FtsJ, RrmJ) methylates the 2′-O ribose of the universally conserved U2552 in the so-called A-loop (hairpin 92) of the Peptidyl Transferase Center (domain V) of 23S rRNA. E. coli RlmE is active only on the ribosome and the 50 S ribosomal subunit, but is inactive on free rRNA. AdoMet is the methyl group donor. The enzyme possess a TRAM domain. The homologous S.cerevisiae mitochondrial enzyme is Mrm2. In cytoplasmic large subunit rRNA, the equivalent Um2921 (2552 in E. coli numbering) is catalyzed by C/D box RNP, using snR52 as guide-RNA.




Reaction Substrate SubstrateType Position (Anti)Codon Modified (Anti)Codon Amino Acid Change Transcript Name Transcript Region Cellular Localization References
U:Um RNA rRNA 2552 LSU-23S Prokaryotic Cytosol 15375145   



Publications:

Title Authors Journal Details PubMed Id DOI
Substrate binding analysis of the 23S rRNA methyltransferase RrmJ. Hager J, Staker BL, Jakob U J Bacteriol [details] 15375145 -
The FtsJ/RrmJ heat shock protein of Escherichia coli is a 23 S ribosomal RNA methyltransferase. Caldas T, Binet E, Bouloc P, Costa A, Desgres J, Richarme G J Biol Chem [details] 10748051 -
RNA methylation under heat shock control. Bugl H, Fauman EB, Staker BL, Zheng F, Kushner SR, Saper MA, Bardwell JC, Jakob U Mol Cell [details] 10983982 -
Active site in RrmJ, a heat shock-induced methyltransferase. Hager J, Staker BL, Bugl H, Jakob U J Biol Chem [details] 12181314 -
Molecular phylogenetics of the RrmJ/fibrillarin superfamily of ribose 2'-O-methyltransferases. Feder M, Pas J, Wyrwicz LS, Bujnicki JM Gene [details] 12527203 -