Modomics - A Database of RNA Modifications

Full name:	Ribosomal RNA large subunit methyltransferase E
Synonym:	RrmJ, Ftsj, MrsF, JW3146
GI:	83287970
Orf:	b3179, c3936, z4541, Ecs4058
COG:	COG0293
UniProt:	P0C0R7
Structures:	\| 1EIZ \| 1EJO \|
Complex:
Enzyme type:	methyltransferase
Position of modification - modification:	l:2552(2552) - Um

Comments:

Substrate analysis showed that RlmE (formerly FtsJ, RrmJ) methylates the 2′-O ribose of the universally conserved U2552 in the so-called A-loop (hairpin 92) of the Peptidyl Transferase Center (domain V) of 23S rRNA. E. coli RlmE is active only on the ribosome and the 50 S ribosomal subunit, but is inactive on free rRNA. AdoMet is the methyl group donor. The enzyme possess a TRAM domain. The homologous S.cerevisiae mitochondrial enzyme is Mrm2. In cytoplasmic large subunit rRNA, the equivalent Um2921 (2552 in E. coli numbering) is catalyzed by C/D box RNP, using snR52 as guide-RNA.

Protein sequence:

MTGKKRSASSSRWLQEHFSDKYVQQAQKKGLRSRAWFKLDEIQQSDKLFKPGMTVVDLGAAPGGWSQYVVTQIGGKGRIIACDLLPMDPIVGVDFLQGDF
RDELVMKALLERVGDSKVQVVMSDMAPNMSGTPAVDIPRAMYLVELALEMCRDVLAPGGSFVVKVFQGEGFDEYLREIRSLFTKVKVRKPDSSRARSREV
YIVATGRKP

Enzymatic activities:

Reaction	Substrate	Type	Position
U:Um	rRNA (r)	LSU/23S/prokaryotic cytosol	2552

Publications:

Title	Authors	Journal	Details	PubMed Id	DOI
Substrate binding analysis of the 23S rRNA methyltransferase RrmJ.	Hager J, Staker BL, Jakob U	J Bacteriol	[details]	15375145	-
The FtsJ/RrmJ heat shock protein of Escherichia coli is a 23 S ribosomal RNA methyltransferase.	Caldas T, Binet E, Bouloc P, Costa A, Desgres J, Richarme G	J Biol Chem	[details]	10748051	-
RNA methylation under heat shock control.	Bugl H, Fauman EB, Staker BL, Zheng F, Kushner SR, Saper MA, Bardwell JC, Jakob U	Mol Cell	[details]	10983982	-
Active site in RrmJ, a heat shock-induced methyltransferase.	Hager J, Staker BL, Bugl H, Jakob U	J Biol Chem	[details]	12181314	-
Molecular phylogenetics of the RrmJ/fibrillarin superfamily of ribose 2'-O-methyltransferases.	Feder M, Pas J, Wyrwicz LS, Bujnicki JM	Gene	[details]	12527203	-