Full name: Ribosomal RNA large subunit methyltransferase G
Synonym: YgjO
GI: 90111535
Orf: b3084, JW5513
COG: COG2813
UniProt: P42596
Structures: | |
Complex:
Enzyme type: methyltransferase
Position of modification - modification: l:1835(1835) - m2G

Comments:

RlmG catalyzes the formation of m2G at position 1835 of helix 67 in domain IV of large ribosomal subunit. Recombinant RlmG protein is able to methylate in vitro protein-free 23S rRNA, but not assembled 50S subunits purified from the ygjO knock-out strain. AdoMet is the methyl group donor.

Protein sequence:

MSHLDNGFRSLTLQRFPATDDVNPLQAWEAADEYLLQQLDDTEIRGPVLILNDAFGALSCALAEHKPYSI GDSYISELATRENLRLNGIDESSVKFLDSTADYPQQPGVVLIKVPKTLALLEQQLRALRKVVTSDTRIIA GAKARDIHTSTLELFEKVLGPTTTTLAWKKARLINCTFNEPQLADAPQTVSWKLEGTDWTIHNHANVFSR TGLDIGARFFMQHLPENLEGEIVDLGCGNGVIGLTLLDKNPQAKVVFVDESPMAVASSRLNVETNMPEAL DRCEFMINNALSGVEPFRFNAVLCNPPFHQQHALTDNVAWEMFHHARRCLKINGELYIVANRHLDYFHKL KKIFGNCTTIATNNKFVVLKAVKLGRRR

Enzymatic activities:

Reaction Substrate Type Position
G:m2G rRNA (r) LSU/23S/prokaryotic cytosol 1835

Publications:

Title Authors Journal Details PubMed Id DOI
Ribosomal RNA guanine-(N2)-methyltransferases and their targets. Sergiev PV, Bogdanov AA, Dontsova OA Nucleic Acids Res [details] 17389639 -
Identification of Escherichia coli m2G methyltransferases: II. The ygjO gene encodes a methyltransferase specific for G1835 of the 23 S rRNA. Sergiev PV, Lesnyak DV, Bogdanov AA, Dontsova OA J Mol Biol [details] 17010380 -
Methylated 23S rRNA nucleotide m2G1835 of Escherichia coli ribosome facilitates subunit association. Osterman IA, Sergiev PV, Tsvetkov PO, Makarov AA, Bogdanov AA, Dontsova OA Biochimie [details] 21237242 -

Links:

_KEGG_
_BRENDA_
Copyright © Genesilico - All rights reserved
If you have any advice or suggestions for corrections or improvements, please contact: Pietro Boccaletto