Modomics - A Database of RNA Modifications

Full name:	Ribosomal RNA large subunit methyltransferase G
Synonym:	YgjO
GI:	90111535
Orf:	b3084, JW5513
COG:	COG2813
UniProt:	P42596
Structures:	\| \|
Complex:
Enzyme type:	methyltransferase
Position of modification - modification:	l:1835(1835) - m2G

Comments:

RlmG catalyzes the formation of m2G at position 1835 of helix 67 in domain IV of large ribosomal subunit. Recombinant RlmG protein is able to methylate in vitro protein-free 23S rRNA, but not assembled 50S subunits purified from the ygjO knock-out strain. AdoMet is the methyl group donor.

Protein sequence:

MSHLDNGFRSLTLQRFPATDDVNPLQAWEAADEYLLQQLDDTEIRGPVLILNDAFGALSCALAEHKPYSIGDSYISELATRENLRLNGIDESSVKFLDST
ADYPQQPGVVLIKVPKTLALLEQQLRALRKVVTSDTRIIAGAKARDIHTSTLELFEKVLGPTTTTLAWKKARLINCTFNEPQLADAPQTVSWKLEGTDWT
IHNHANVFSRTGLDIGARFFMQHLPENLEGEIVDLGCGNGVIGLTLLDKNPQAKVVFVDESPMAVASSRLNVETNMPEALDRCEFMINNALSGVEPFRFN
AVLCNPPFHQQHALTDNVAWEMFHHARRCLKINGELYIVANRHLDYFHKLKKIFGNCTTIATNNKFVVLKAVKLGRRR

Enzymatic activities:

Reaction	Substrate	Type	Position
G:m2G	rRNA (r)	LSU/23S/prokaryotic cytosol	1835

Publications:

Title	Authors	Journal	Details	PubMed Id	DOI
Ribosomal RNA guanine-(N2)-methyltransferases and their targets.	Sergiev PV, Bogdanov AA, Dontsova OA	Nucleic Acids Res	[details]	17389639	-
Identification of Escherichia coli m2G methyltransferases: II. The ygjO gene encodes a methyltransferase specific for G1835 of the 23 S rRNA.	Sergiev PV, Lesnyak DV, Bogdanov AA, Dontsova OA	J Mol Biol	[details]	17010380	-
Methylated 23S rRNA nucleotide m2G1835 of Escherichia coli ribosome facilitates subunit association.	Osterman IA, Sergiev PV, Tsvetkov PO, Makarov AA, Bogdanov AA, Dontsova OA	Biochimie	[details]	21237242	-

Links:

_BRENDA_
_KEGG_

_BRENDA_

_KEGG_