Full name: Ribosomal RNA large subunit methyltransferase F
Synonym: YbiN, JW5107
GI: 3915947
Orf: b0807
COG: COG3129
UniProt: P75782
Structures: | |
Complex:
Enzyme type: methyltransferase
Position of modification - modification: l:1618(1618) - m6A

Comments:

This enzyme catalyzes the site-specific formation of m6A at position 1618 in the loop of the mini hairpin 59a in domain III of the large subunit of rRNA, located nearby the peptide tunnel of the ribosome. Recombinant RlmF protein is able to methylate partially deproteinized 50S ribosomal subunit, but neither the completely assembled 50S subunits nor completely deproteinized 23S rRNA. AdoMet is the methyl group donor. The C-terminal domain of RlmF is related to the ones of RsmC (m2G1209)/RsmD(m2G966).

Protein sequence:

MSAQKPGLHPRNRHHSRYDLATLCQVNPELRQFLTLTPAGEQSVDFANPLAVKALNKALLAHFYAVANWD IPDGFLCPPVPGRADYIHHLADLLAEASGTIPANASILDIGVGANCIYPLIGVHEYGWRFTGSETSSQAL SSAQAIISSNPGLNRAIRLRRQKESGAIFNGIIHKNEQYDATLCNPPFHDSAAAARAGSERKRRNLGLNK DDALNFGGQQQELWCEGGEVTFIKKMIEESKGFAKQVMWFTSLVSRGENLPPLYRALTDVGAVKVVKKEM AQGQKQSRFIAWTFMNDEQRRRFVNRQR

Enzymatic activities:

Reaction Substrate Type Position
A:m6A rRNA (r) LSU/23S/prokaryotic cytosol 1618

Publications:

Title Authors Journal Details PubMed Id DOI
The ybiN gene of Escherichia coli encodes adenine-N6 methyltransferase specific for modification of A1618 of 23 S ribosomal RNA, a methylated residue located close to the ribosomal exit tunnel. Sergiev PV, Serebryakova MV, Bogdanov AA, Dontsova OA J Mol Biol [details] 18021804 -
Copyright © Genesilico - All rights reserved
If you have any advice or suggestions for corrections or improvements, please contact: Pietro Boccaletto