Full name: GTP-RNA guanylyltransferase
Synonym: GTase, Mce1
GI: 1322697
Orf: CEG1
COG: COG5226
UniProt: Q01159
Structures: | 3KYH |
Complex:
Enzyme type: guanylyltransferase
Position of modification - modification: m:0 - m7Gpp(pN)

Comments:

The yeast capping enzyme (Ceg1p/Cet1p) represses RNA polymerase II transcription in vivo, suggesting a bidirectional flow of information between capping and transcription

Protein sequence:

MVLAMESRVAPEIPGLIQPGNVTQDLKMMVCKLLNSPKPTKTFPGSQPVSFQHSDVEEKLLAHDYYVCEK TDGLRVLMFIVINPVTGEQGCFMIDRENNYYLVNGFRFPRLPQKKKEELLETLQDGTLLDGELVIQTNPM TKLQELRYLMFDCLAINGRCLTQSPTSSRLAHLGKEFFKPYFDLRAAYPNRCTTFPFKISMKHMDFSYQL VKVAKSLDKLPHLSDGLIFTPVKAPYTAGGKDSLLLKWKPEQENTVDFKLILDIPMVEDPSLPKDDRNRW YYNYDVKPVFSLYVWQGGADVNSRLKHFDQPFDRKEFEILERTYRKFAELSVSDEEWQNLKNLEQPLNGR IVECAKNQETGAWEMLRFRDDKLNGNHTSVVQKVLESINDSVSLEDLEEIVGDIKRCWDERRANMAGGSG RPLPSQSQNATLSTSKPVHSQPPSNDKEPKYVDEDDWSD

Enzymatic activities:

Reaction Substrate Type Position
p(pN):Gpp(pN) mRNA (m) 0

Publications:

Title Authors Journal Details PubMed Id DOI
mRNA capping enzyme. Isolation and characterization of the gene encoding mRNA guanylytransferase subunit from Saccharomyces cerevisiae. Shibagaki Y, Itoh N, Yamada H, Nagata S, Mizumoto K J Biol Chem [details] 1315757 -
Isolation of temperature-sensitive mutants for mRNA capping enzyme in Saccharomyces cerevisiae. Yamagishi M, Mizumoto K, Ishihama A Mol Gen Genet [details] 7500935 -
Messenger RNA guanylyltransferase from Saccharomyces cerevisiae. Large scale purification, subunit functions, and subcellular localization. Itoh N, Yamada H, Kaziro Y, Mizumoto K J Biol Chem [details] 3029058 -
Structure of the Saccharomyces cerevisiae Cet1-Ceg1 mRNA capping apparatus. Gu M, Rajashankar KR, Lima CD Structure [details] 20159466 -
An essential function of Saccharomyces cerevisiae RNA triphosphatase Cet1 is to stabilize RNA guanylyltransferase Ceg1 against thermal inactivation. Hausmann S, Ho CK, Schwer B, Shuman S... J Biol Chem [details] 11463793 -

Links:

_Wikipedia_
_PubMed_
Copyright © Genesilico - All rights reserved
If you have any advice or suggestions for corrections or improvements, please contact: Pietro Boccaletto