Modomics - A Database of RNA Modifications

Full name:	GTP-RNA guanylyltransferase
Synonym:	GTase, Mce1
GI:	1322697
Orf:	CEG1
COG:	COG5226
UniProt:	Q01159
Structures:	\| 3KYH \|
Complex:
Enzyme type:	guanylyltransferase
Position of modification - modification:	m:0 - m7GpppN

Comments:

The yeast capping enzyme (Ceg1p/Cet1p) represses RNA polymerase II transcription in vivo, suggesting a bidirectional flow of information between capping and transcription

Protein sequence:

MVLAMESRVAPEIPGLIQPGNVTQDLKMMVCKLLNSPKPTKTFPGSQPVSFQHSDVEEKLLAHDYYVCEKTDGLRVLMFIVINPVTGEQGCFMIDRENNY
YLVNGFRFPRLPQKKKEELLETLQDGTLLDGELVIQTNPMTKLQELRYLMFDCLAINGRCLTQSPTSSRLAHLGKEFFKPYFDLRAAYPNRCTTFPFKIS
MKHMDFSYQLVKVAKSLDKLPHLSDGLIFTPVKAPYTAGGKDSLLLKWKPEQENTVDFKLILDIPMVEDPSLPKDDRNRWYYNYDVKPVFSLYVWQGGAD
VNSRLKHFDQPFDRKEFEILERTYRKFAELSVSDEEWQNLKNLEQPLNGRIVECAKNQETGAWEMLRFRDDKLNGNHTSVVQKVLESINDSVSLEDLEEI
VGDIKRCWDERRANMAGGSGRPLPSQSQNATLSTSKPVHSQPPSNDKEPKYVDEDDWSD

Enzymatic activities:

Reaction	Substrate	Type	Position
ppN:GpppN	mRNA (m)		0

Publications:

Title	Authors	Journal	Details	PubMed Id	DOI
mRNA capping enzyme. Isolation and characterization of the gene encoding mRNA guanylytransferase subunit from Saccharomyces cerevisiae.	Shibagaki Y, Itoh N, Yamada H, Nagata S, Mizumoto K	J Biol Chem	[details]	1315757	-
Isolation of temperature-sensitive mutants for mRNA capping enzyme in Saccharomyces cerevisiae.	Yamagishi M, Mizumoto K, Ishihama A	Mol Gen Genet	[details]	7500935	-
Messenger RNA guanylyltransferase from Saccharomyces cerevisiae. Large scale purification, subunit functions, and subcellular localization.	Itoh N, Yamada H, Kaziro Y, Mizumoto K	J Biol Chem	[details]	3029058	-
Structure of the Saccharomyces cerevisiae Cet1-Ceg1 mRNA capping apparatus.	Gu M, Rajashankar KR, Lima CD	Structure	[details]	20159466	-
An essential function of Saccharomyces cerevisiae RNA triphosphatase Cet1 is to stabilize RNA guanylyltransferase Ceg1 against thermal inactivation.	Hausmann S, Ho CK, Schwer B, Shuman S...	J Biol Chem	[details]	11463793	-

Links:

_PubMed_
_Wikipedia_

_PubMed_

_Wikipedia_