Full name: tRNA pseudouridine synthase 1
Synonym:
GI: 3122655
Orf: YPL212C
COG: COG0101
UniProt: Q12211
Structures: | |
Complex:
Enzyme type: pseudouridine synthase
Position of modification - modification: t:27 - Y
t:28 - Y
t:35 - Y
t:34 - Y
t:36 - Y
n:44 - Y

Comments:

Multisite, multisubstrate specificity. Forms pseudouridine at positions 27 and 28 in the anticodon stem and loop of transfer RNAs; at positions 34 and 36 of intron-containing precursor tRNA(Ile) and at position 35 in the intron-containing tRNA(Tyr). Modifies also U2 snRNA. Zinc enzyme. Pus1 in other organisms may exhibit different specificity.

Protein sequence:

MSEENLRPAYDDQVNEDVYKRGAQSKLTKARKADFDDEKDKKKDNDKHIDKRPKSGPRLDENGNPLPKEP RLPKRKVAVMVGYCGTGYHGMQYNPPNPTIESALFKAFVEAGAISKDNSNDLKKNGFMRAARTDKGVHAG GNLISLKMIIEDPDIKQKINEKLPEGIRVWDIERVNKAFDCRKMCSSRWYEYLLPTYSLIGPKPGSILYR DIEESKTELPGVLDEDLESKEFWEEFKKDANEKFSTEEIEAILAYVPPARDEFDINEELYQKVKKYKQLE NAHRRRYRISAAKLAKFRASTSQYLGAHNFHNFTLGKDFKEPSAIRFMKDIKVSDPFVIGDAQTEWISIK IHGQSFMLHQIRKMVSMATLITRCGCPVERISQAYGQQKINIPKAPALGLLLEAPVFEGYNKRLEQFGYK AIDFSKYQDEVDKFKMKHIYDKIYKEEVDENVFNAFFSYIDSFNKVTGAQGEETADKSGPAVQKSIFEFL TAKGIPGLTDAPESNKKIKQRKRMEEEEAASKKAEISSTTQSNEPEVQPEAAAN

Enzymatic activities:

Reaction Substrate Type Position
U:Y snRNA (sn)   44
U:Y tRNA (t) Ile/UAU/prokaryotic cytosol 27
U:Y tRNA (t) Val/UAC/prokaryotic cytosol 27
U:Y tRNA (t) Val/CAC/prokaryotic cytosol 27
U:Y tRNA (t) Val/CAC/prokaryotic cytosol 28
U:Y tRNA (t) Trp/CCA/prokaryotic cytosol 27
U:Y tRNA (t) Trp/CCA/prokaryotic cytosol 28
U:Y tRNA (t) Lys/SUU/prokaryotic cytosol 67
U:Y tRNA (t) Arg/ACU/prokaryotic cytosol 27
U:Y tRNA (t) Arg/ICG/prokaryotic cytosol 27
U:Y tRNA (t) Glu/CUC/prokaryotic cytosol 27
U:Y tRNA (t)   27
U:Y tRNA (t) Lys/CUU/prokaryotic cytosol 27
U:Y tRNA (t) Lys/SUU/prokaryotic cytosol 27
U:Y tRNA (t) Lys/SUU/prokaryotic cytosol 28
U:Y tRNA (t) Met/CAU/prokaryotic cytosol 27
U:Y pre-tRNA (pre-t) Tyr/GUA/prokaryotic cytosol 35
U:Y tRNA (t) Trp/CCA/prokaryotic cytosol 65
U:Y tRNA (t) Ile/UAU/prokaryotic cytosol 67
U:Y tRNA (t) Trp/CCA/prokaryotic cytosol 26
U:Y pre-tRNA (pre-t) Ile/UAU/prokaryotic cytosol 27
U:Y pre-tRNA (pre-t) Ile/UAU/prokaryotic cytosol 34
U:Y pre-tRNA (pre-t) Ile/UAU/prokaryotic cytosol 36
U:Y tRNA (t) Arg/ICG/prokaryotic cytosol 1
U:Y tRNA (t) Trp/BCA/cytosolic 26

Publications:

Title Authors Journal Details PubMed Id DOI
The yeast tRNA:pseudouridine synthase Pus1p displays a multisite substrate specificity. Motorin Y, Keith G, Simon C, Foiret D, Simos G, Hurt E, Grosjean H RNA [details] 9671058 -
Pseudouridine mapping in the Saccharomyces cerevisiae spliceosomal U small nuclear RNAs (snRNAs) reveals that pseudouridine synthase pus1p exhibits a dual substrate specificity for U2 snRNA and tRNA. Massenet S, Motorin Y, Lafontaine DL, Hurt EC, Grosjean H, Branlant C Mol Cell Biol [details] 10022901 -
A previously unidentified activity of yeast and mouse RNA:pseudouridine synthases 1 (Pus1p) on tRNAs. Behm-Ansmant I, Massenet S, Immel F, Patton JR, Motorin Y, Branlant C RNA [details] 16804160 -
RNA:pseudouridine synthetase Pus1 from Saccharomyces cerevisiae: oligomerization property and stoichiometry of the complex with yeast tRNA(Phe). Arluison V, Batelier G, Riès-Kautt M, Grosjean H Biochimie [details] 10492022 -
Pseudouridine synthetase Pus1 of Saccharomyces cerevisiae: kinetic characterisation, tRNA structural requirement and real-time analysis of its complex with tRNA. Arluison V, Buckle M, Grosjean H J Mol Biol [details] 10356324 -
Transfer RNA-pseudouridine synthetase Pus1 of Saccharomyces cerevisiae contains one atom of zinc essential for its native conformation and tRNA recognition. Arluison V, Hountondji C, Robert B, Grosjean H Biochemistry [details] 9585540 -
Copyright © Genesilico - All rights reserved
If you have any advice or suggestions for corrections or improvements, please contact: Pietro Boccaletto