MSEENLRPAYDDQVNEDVYKRGAQSKLTKARKADFDDEKDKKKDNDKHIDKRPKSGPRLDENGNPLPKEPRLPKRKVAVMVGYCGTGYHGMQYNPPNPTI ESALFKAFVEAGAISKDNSNDLKKNGFMRAARTDKGVHAGGNLISLKMIIEDPDIKQKINEKLPEGIRVWDIERVNKAFDCRKMCSSRWYEYLLPTYSLI GPKPGSILYRDIEESKTELPGVLDEDLESKEFWEEFKKDANEKFSTEEIEAILAYVPPARDEFDINEELYQKVKKYKQLENAHRRRYRISAAKLAKFRAS TSQYLGAHNFHNFTLGKDFKEPSAIRFMKDIKVSDPFVIGDAQTEWISIKIHGQSFMLHQIRKMVSMATLITRCGCPVERISQAYGQQKINIPKAPALGL LLEAPVFEGYNKRLEQFGYKAIDFSKYQDEVDKFKMKHIYDKIYKEEVDENVFNAFFSYIDSFNKVTGAQGEETADKSGPAVQKSIFEFLTAKGIPGLTD APESNKKIKQRKRMEEEEAASKKAEISSTTQSNEPEVQPEAAAN
Reaction | Substrate | Type | Position |
---|---|---|---|
U:Y | snRNA (sn) | 44 | |
U:Y | tRNA (t) | Ile/UAU/prokaryotic cytosol | 27 |
U:Y | tRNA (t) | Val/UAC/prokaryotic cytosol | 27 |
U:Y | tRNA (t) | Val/CAC/prokaryotic cytosol | 27 |
U:Y | tRNA (t) | Val/CAC/prokaryotic cytosol | 28 |
U:Y | tRNA (t) | Trp/CCA/prokaryotic cytosol | 27 |
U:Y | tRNA (t) | Trp/CCA/prokaryotic cytosol | 28 |
U:Y | tRNA (t) | Lys/SUU/prokaryotic cytosol | 67 |
U:Y | tRNA (t) | Arg/ACU/prokaryotic cytosol | 27 |
U:Y | tRNA (t) | Arg/ICG/prokaryotic cytosol | 27 |
U:Y | tRNA (t) | Glu/CUC/prokaryotic cytosol | 27 |
U:Y | tRNA (t) | 27 | |
U:Y | tRNA (t) | Lys/CUU/prokaryotic cytosol | 27 |
U:Y | tRNA (t) | Lys/SUU/prokaryotic cytosol | 27 |
U:Y | tRNA (t) | Lys/SUU/prokaryotic cytosol | 28 |
U:Y | tRNA (t) | Met/CAU/prokaryotic cytosol | 27 |
U:Y | pre-tRNA (pre-t) | Tyr/GUA/prokaryotic cytosol | 35 |
U:Y | tRNA (t) | Trp/CCA/prokaryotic cytosol | 65 |
U:Y | tRNA (t) | Ile/UAU/prokaryotic cytosol | 67 |
U:Y | tRNA (t) | Trp/CCA/prokaryotic cytosol | 26 |
U:Y | pre-tRNA (pre-t) | Ile/UAU/prokaryotic cytosol | 27 |
U:Y | pre-tRNA (pre-t) | Ile/UAU/prokaryotic cytosol | 34 |
U:Y | pre-tRNA (pre-t) | Ile/UAU/prokaryotic cytosol | 36 |
U:Y | tRNA (t) | Arg/ICG/prokaryotic cytosol | 1 |
U:Y | tRNA (t) | Trp/BCA/eukaryotic cytosol | 26 |
Title | Authors | Journal | Details | ||
---|---|---|---|---|---|
The yeast tRNA:pseudouridine synthase Pus1p displays a multisite substrate specificity. | Motorin Y, Keith G, Simon C, Foiret D, Simos G, Hurt E, Grosjean H | RNA | [details] | 9671058 | - |
Pseudouridine mapping in the Saccharomyces cerevisiae spliceosomal U small nuclear RNAs (snRNAs) reveals that pseudouridine synthase pus1p exhibits a dual substrate specificity for U2 snRNA and tRNA. | Massenet S, Motorin Y, Lafontaine DL, Hurt EC, Grosjean H, Branlant C | Mol Cell Biol | [details] | 10022901 | - |
A previously unidentified activity of yeast and mouse RNA:pseudouridine synthases 1 (Pus1p) on tRNAs. | Behm-Ansmant I, Massenet S, Immel F, Patton JR, Motorin Y, Branlant C | RNA | [details] | 16804160 | - |
RNA:pseudouridine synthetase Pus1 from Saccharomyces cerevisiae: oligomerization property and stoichiometry of the complex with yeast tRNA(Phe). | Arluison V, Batelier G, Riès-Kautt M, Grosjean H | Biochimie | [details] | 10492022 | - |
Pseudouridine synthetase Pus1 of Saccharomyces cerevisiae: kinetic characterisation, tRNA structural requirement and real-time analysis of its complex with tRNA. | Arluison V, Buckle M, Grosjean H | J Mol Biol | [details] | 10356324 | - |
Transfer RNA-pseudouridine synthetase Pus1 of Saccharomyces cerevisiae contains one atom of zinc essential for its native conformation and tRNA recognition. | Arluison V, Hountondji C, Robert B, Grosjean H | Biochemistry | [details] | 9585540 | - |