Modomics - A Database of RNA Modifications

Full name:	tRNA pseudouridine synthase 1
Synonym:
GI:	3122655
Orf:	YPL212C
COG:	COG0101
UniProt:	Q12211
Structures:	\| \|
Complex:
Enzyme type:	pseudouridine synthase
Position of modification - modification:	t:34 - Y t:36 - Y n:44 - Y t:35 - Y t:27 - Y t:28 - Y

Comments:

Multisite, multisubstrate specificity. Forms pseudouridine at positions 27 and 28 in the anticodon stem and loop of transfer RNAs; at positions 34 and 36 of intron-containing precursor tRNA(Ile) and at position 35 in the intron-containing tRNA(Tyr). Modifies also U2 snRNA. Zinc enzyme. Pus1 in other organisms may exhibit different specificity.

Protein sequence:

MSEENLRPAYDDQVNEDVYKRGAQSKLTKARKADFDDEKDKKKDNDKHIDKRPKSGPRLDENGNPLPKEPRLPKRKVAVMVGYCGTGYHGMQYNPPNPTI
ESALFKAFVEAGAISKDNSNDLKKNGFMRAARTDKGVHAGGNLISLKMIIEDPDIKQKINEKLPEGIRVWDIERVNKAFDCRKMCSSRWYEYLLPTYSLI
GPKPGSILYRDIEESKTELPGVLDEDLESKEFWEEFKKDANEKFSTEEIEAILAYVPPARDEFDINEELYQKVKKYKQLENAHRRRYRISAAKLAKFRAS
TSQYLGAHNFHNFTLGKDFKEPSAIRFMKDIKVSDPFVIGDAQTEWISIKIHGQSFMLHQIRKMVSMATLITRCGCPVERISQAYGQQKINIPKAPALGL
LLEAPVFEGYNKRLEQFGYKAIDFSKYQDEVDKFKMKHIYDKIYKEEVDENVFNAFFSYIDSFNKVTGAQGEETADKSGPAVQKSIFEFLTAKGIPGLTD
APESNKKIKQRKRMEEEEAASKKAEISSTTQSNEPEVQPEAAAN

Enzymatic activities:

Reaction	Substrate	Type	Position
U:Y	snRNA (sn)		44
U:Y	tRNA (t)	Ile/UAU/prokaryotic cytosol	27
U:Y	tRNA (t)	Val/UAC/prokaryotic cytosol	27
U:Y	tRNA (t)	Val/CAC/prokaryotic cytosol	27
U:Y	tRNA (t)	Val/CAC/prokaryotic cytosol	28
U:Y	tRNA (t)	Trp/CCA/prokaryotic cytosol	27
U:Y	tRNA (t)	Trp/CCA/prokaryotic cytosol	28
U:Y	tRNA (t)	Lys/SUU/prokaryotic cytosol	67
U:Y	tRNA (t)	Arg/ACU/prokaryotic cytosol	27
U:Y	tRNA (t)	Arg/ICG/prokaryotic cytosol	27
U:Y	tRNA (t)	Glu/CUC/prokaryotic cytosol	27
U:Y	tRNA (t)		27
U:Y	tRNA (t)	Lys/CUU/prokaryotic cytosol	27
U:Y	tRNA (t)	Lys/SUU/prokaryotic cytosol	27
U:Y	tRNA (t)	Lys/SUU/prokaryotic cytosol	28
U:Y	tRNA (t)	Met/CAU/prokaryotic cytosol	27
U:Y	pre-tRNA (pre-t)	Tyr/GUA/prokaryotic cytosol	35
U:Y	tRNA (t)	Trp/CCA/prokaryotic cytosol	65
U:Y	tRNA (t)	Ile/UAU/prokaryotic cytosol	67
U:Y	tRNA (t)	Trp/CCA/prokaryotic cytosol	26
U:Y	pre-tRNA (pre-t)	Ile/UAU/prokaryotic cytosol	27
U:Y	pre-tRNA (pre-t)	Ile/UAU/prokaryotic cytosol	34
U:Y	pre-tRNA (pre-t)	Ile/UAU/prokaryotic cytosol	36
U:Y	tRNA (t)	Arg/ICG/prokaryotic cytosol	1
U:Y	tRNA (t)	Trp/BCA/eukaryotic cytosol	26

Publications:

Title	Authors	Journal	Details	PubMed Id	DOI
The yeast tRNA:pseudouridine synthase Pus1p displays a multisite substrate specificity.	Motorin Y, Keith G, Simon C, Foiret D, Simos G, Hurt E, Grosjean H	RNA	[details]	9671058	-
Pseudouridine mapping in the Saccharomyces cerevisiae spliceosomal U small nuclear RNAs (snRNAs) reveals that pseudouridine synthase pus1p exhibits a dual substrate specificity for U2 snRNA and tRNA.	Massenet S, Motorin Y, Lafontaine DL, Hurt EC, Grosjean H, Branlant C	Mol Cell Biol	[details]	10022901	-
A previously unidentified activity of yeast and mouse RNA:pseudouridine synthases 1 (Pus1p) on tRNAs.	Behm-Ansmant I, Massenet S, Immel F, Patton JR, Motorin Y, Branlant C	RNA	[details]	16804160	-
RNA:pseudouridine synthetase Pus1 from Saccharomyces cerevisiae: oligomerization property and stoichiometry of the complex with yeast tRNA(Phe).	Arluison V, Batelier G, Riès-Kautt M, Grosjean H	Biochimie	[details]	10492022	-
Pseudouridine synthetase Pus1 of Saccharomyces cerevisiae: kinetic characterisation, tRNA structural requirement and real-time analysis of its complex with tRNA.	Arluison V, Buckle M, Grosjean H	J Mol Biol	[details]	10356324	-
Transfer RNA-pseudouridine synthetase Pus1 of Saccharomyces cerevisiae contains one atom of zinc essential for its native conformation and tRNA recognition.	Arluison V, Hountondji C, Robert B, Grosjean H	Biochemistry	[details]	9585540	-