Full name: tRNA pseudouridine synthase 2
Synonym:
GI: 347595823
Orf: YGL063W
COG: COG0101
UniProt: P53167
Structures: | |
Complex:
Enzyme type: pseudouridine synthase
Position of modification - modification: t:27 - Y

Comments:

Specificity unpublished

Protein sequence:

MLLGYCGSGYYGMQYNPPHKTIEGEILTKLFDVGAISEENSLAPKKNSFMAAARTDKGVHAMLNLLSLKI TLREDTVAKLNAALPPEIRVWGIQPVNKKFNARSACDSRWYQYLIPEFILIGPPRSSLLHRNVGGSYRED GSQEVWDTFLEQTRGRFSGDELCRLQDTAQKLSESDPLVQDYVGLLSGTLSGYCLSPSKLDAFEAAMQEY VGTHNFHNFTTGKLWGDPSAQRHIKKVVVSQASPGWICVRIHGQSFMLHQIRRMVALAVLAARCQLPPNI VRNYFNAGPRKYIPRAPAQGLLLEGPVFDGYNTKLRNLLYCEIRPDDITLERMCRFRERQICTAIAHEET QRHVFCHFVRQMNRLATPLI

Enzymatic activities:

Reaction Substrate Type Position
U:Y tRNA (t) Arg/UCU/mitochondrial 26
U:Y tRNA (t) Arg/ACG/mitochondrial 26
U:Y tRNA (t) His/GUG/mitochondrial 26
U:Y tRNA (t) Ser/UAG/mitochondrial 26
U:Y tRNA (t) Thr/UAG/mitochondrial 26
U:Y tRNA (t) Tyr/GUA/mitochondrial 26
U:Y tRNA (t) Lys/UUU/mitochondrial 27

Publications:

Title Authors Journal Details PubMed Id DOI
The Saccharomyces cerevisiae Pus2 protein encoded by YGL063w ORF is a mitochondrial tRNA:Psi27/28-synthase. Behm-Ansmant I, Branlant C, Motorin Y RNA [details] 17684231 -
Copyright © Genesilico - All rights reserved
If you have any advice or suggestions for corrections or improvements, please contact: Pietro Boccaletto