Full name: tRNA pseudouridine synthase 3
Synonym: Deg1p, Hrm3
GI: 399356
Orf: YFL001W
COG: COG0101
UniProt: P31115
Structures: | |
Complex:
Enzyme type: pseudouridine synthase
Position of modification - modification: t:39 - Y
t:38 - Y

Comments:

Region specificity.Monomeric enzyme.

Protein sequence:

MSNFIRRLVGKMKAISTGTNAIVSKKDSIYANWSKEQLIRRITELENANKPHSEKFQHIEDNKKRKISQE EVTRSKAKKAPKKFDFSKHNTRFIALRFAYLGWNYNGLAVQKEYTPLPTVEGTILEAMNKCKLVPSMVLQ DYKFSRCGRTDKGVSAMNQVISLEVRSNLTDEEQRDPTNDSREIPYVHVLNQLLPDDIRISAVCLRPPPN FDARFSCVHRHYKYIFNGKNLNIEKMSKAASYFVGERDFRNFCKLDGSKQITNFKRTIISSKILPLSETF YCFDLVGSAFLWHQVRCMMAILFLVGQSLEVPEIVLRLTDIEKTPQRPVYEMANDIPLLLYDCKFPEMDW QEPTVDDYKAIKFTTATEALTLHYELKAAVCNIFKDVLPTANTNNFSKTIINLGDGRGKVVGTYVKLEDR SVMEPVEVVNAKYSKKKNNKNK

Enzymatic activities:

Reaction Substrate Type Position
U:Y tRNA (t) Ala/IGC/prokaryotic cytosol 38
U:Y tRNA (t) Gly/GCC/prokaryotic cytosol 38
U:Y tRNA (t) Arg/ACU/prokaryotic cytosol 39
U:Y tRNA (t) Asn/GUU/prokaryotic cytosol 39
U:Y tRNA (t) Cys/GCA/prokaryotic cytosol 39
U:Y tRNA (t) His/GUG/prokaryotic cytosol 39
U:Y tRNA (t)   39
U:Y tRNA (t) Leu/CAA/prokaryotic cytosol 39
U:Y tRNA (t)   39
U:Y tRNA (t) Lys/CUU/prokaryotic cytosol 39
U:Y tRNA (t) Met/CAU/prokaryotic cytosol 39
U:Y tRNA (t) Phe/GAA/prokaryotic cytosol 39
U:Y tRNA (t) Ser/CGA/prokaryotic cytosol 39
U:Y tRNA (t) Ser/UGA/prokaryotic cytosol 39
U:Y tRNA (t) Ser/IGA/prokaryotic cytosol 39
U:Y tRNA (t) Thr/IGU/prokaryotic cytosol 39
U:Y tRNA (t) Trp/CCA/prokaryotic cytosol 39
U:Y tRNA (t) Tyr/GUA/prokaryotic cytosol 39
U:Y tRNA (t) His/GUG/mitochondrial 38
U:Y tRNA (t) Thr/UAG/mitochondrial 38
U:Y tRNA (t) Arg/UCU/mitochondrial 39
U:Y tRNA (t) Arg/ACG/mitochondrial 39
U:Y tRNA (t) Leu/UAA/mitochondrial 39
U:Y tRNA (t) Phe/GAA/mitochondrial 39
U:Y tRNA (t) Ser/UGA/mitochondrial 39
U:Y tRNA (t) Trp/UCA/mitochondrial 39

Publications:

Title Authors Journal Details PubMed Id DOI
Characterization of yeast protein Deg1 as pseudouridine synthase (Pus3) catalyzing the formation of psi 38 and psi 39 in tRNA anticodon loop. Lecointe F, Simos G, Sauer A, Hurt EC, Motorin Y, Grosjean H J Biol Chem [details] 9430663 -
Copyright © Genesilico - All rights reserved
If you have any advice or suggestions for corrections or improvements, please contact: Pietro Boccaletto