Full name: tRNA pseudouridine synthase 4
Synonym:
GI: 1353109
Orf: YNL292W
COG: COG0130
UniProt: P48567
Structures: | |
Complex:
Enzyme type: pseudouridine synthase
Position of modification - modification: t:55 - Y

Comments:

Acts on mitochondrial and cytoplasmic tRNAs. Monomeric enzyme.

Protein sequence:

MNGIFAIEKPSGITSNQFMLKLQHALTKSQVFSKEIQRATAERKQQYEKQTGKKASKRKLRKVSKVKMGH GGTLDPLASGVLVIGIGAGTKKLANYLSGTVKVYESEALFGVSTTSGDVEGEILSQNSVKHLNFDDLKTV EEKFVGQLKQTPPIYAALKMDGKPLHEYAREGKPLPRAIEPRQVTIYDLKVFSDSLKRDHDYPLLRPTTE EAVDTVKNLNANMLNDVLYFSKEYTEKHGLDSEVAKVEEPFPLSEQEEQEIQKEGDSYRAPKLHFKANVS SGTYIRSLVSDIGKSMRSSCYMVKLIRLQQQDWSLEKNNVFQLTDFTERDEKVWSKVLEKVLDEGATVDV IEELKKAEKEIPADVKECIVSSDQPGDEATAETIETANAEEHSNTLKRKIEQV

Enzymatic activities:

Reaction Substrate Type Position
U:Y tRNA (t) Ala/IGC/prokaryotic cytosol 55
U:Y tRNA (t) Arg/ACU/prokaryotic cytosol 55
U:Y tRNA (t) Arg/ICG/prokaryotic cytosol 55
U:Y tRNA (t) Asn/GUU/prokaryotic cytosol 55
U:Y tRNA (t) Asp/GUC/prokaryotic cytosol 55
U:Y tRNA (t) Cys/GCA/prokaryotic cytosol 55
U:Y tRNA (t) Glu/CUC/prokaryotic cytosol 55
U:Y tRNA (t) Gly/GCC/prokaryotic cytosol 55
U:Y tRNA (t) Gly/{CC/prokaryotic cytosol 55
U:Y tRNA (t) His/GUG/prokaryotic cytosol 55
U:Y tRNA (t) Ile/IAU/prokaryotic cytosol 55
U:Y tRNA (t) Ile/UAU/prokaryotic cytosol 55
U:Y tRNA (t) Leu/UAG/prokaryotic cytosol 55
U:Y tRNA (t) Leu/CAA/prokaryotic cytosol 55
U:Y tRNA (t) Leu/UAA/prokaryotic cytosol 55
U:Y tRNA (t) Lys/CUU/prokaryotic cytosol 55
U:Y tRNA (t) Lys/SUU/prokaryotic cytosol 55
U:Y tRNA (t) Met/CAU/prokaryotic cytosol 55
U:Y tRNA (t) Phe/GAA/prokaryotic cytosol 55
U:Y tRNA (t) Pro/UGG/prokaryotic cytosol 55
U:Y tRNA (t) Ser/CGA/prokaryotic cytosol 55
U:Y tRNA (t) Ser/UGA/prokaryotic cytosol 55
U:Y tRNA (t) Ser/IGA/prokaryotic cytosol 55
U:Y tRNA (t) Thr/IGU/prokaryotic cytosol 55
U:Y tRNA (t) Trp/CCA/prokaryotic cytosol 55
U:Y tRNA (t) Tyr/GUA/prokaryotic cytosol 55
U:Y tRNA (t) Val/UAC/prokaryotic cytosol 55
U:Y tRNA (t) Val/CAC/prokaryotic cytosol 55
U:Y tRNA (t) Val/IAC/prokaryotic cytosol 55
U:Y tRNA (t) Arg/UCU/mitochondrial 55
U:Y tRNA (t) Arg/ACG/mitochondrial 55
U:Y tRNA (t) Gly/UCC/mitochondrial 55
U:Y tRNA (t) His/GUG/mitochondrial 55
U:Y tRNA (t) Ile/GAU/mitochondrial 55
U:Y tRNA (t) Leu/UAA/mitochondrial 55
U:Y tRNA (t) Lys/UUU/mitochondrial 55
U:Y tRNA (t) Met/CAU/mitochondrial 55
U:Y tRNA (t) Phe/GAA/mitochondrial 55
U:Y tRNA (t) Pro/UGG/mitochondrial 55
U:Y tRNA (t) Ser/UGA/mitochondrial 55
U:Y tRNA (t) Ser/GCU/mitochondrial 55
U:Y tRNA (t) Thr/UAG/mitochondrial 55
U:Y tRNA (t) Trp/UCA/mitochondrial 55
U:Y tRNA (t) Tyr/GUA/mitochondrial 55
U:Y tRNA (t)   55

Publications:

Title Authors Journal Details PubMed Id DOI
The yeast gene YNL292w encodes a pseudouridine synthase (Pus4) catalyzing the formation of psi55 in both mitochondrial and cytoplasmic tRNAs. Becker HF, Motorin Y, Planta RJ, Grosjean H Nucleic Acids Res [details] 9358157 -
Copyright © Genesilico - All rights reserved
If you have any advice or suggestions for corrections or improvements, please contact: Pietro Boccaletto