Full name: Pseudouridine synthase 5
Synonym:
GI: 74644954
Orf: YLR165c
COG: COG0564
UniProt: Q06244
Structures: | |
Complex:
Enzyme type: pseudouridine synthase
Position of modification - modification: l:2819(2580) - Y

Comments:

Acts on mitochondrial rRNA.

Protein sequence:

MSLKKQIPIIFENTHYFIVNKPPGIPSQPPDCRTWGRTHPNLDPTPLLERFKAIYYSHREVELCRTVHRL DHCVTGGMLIAKTKDGSVKFSRFLQKGGNNGYKLQRKYVAIVESSGRFNKPNNYEIKYGPKYNFLISHGG REITKFKEVDENCIVLQLVTGKKHQIRNHVSQILNQPILNDKRHGSTVNFPELFNDQIALHSACIITKIG LQTKTHLIPMEHNNTGQLWSRKYVNEEGEFTLPIKEVLLENWDQ

Enzymatic activities:

Reaction Substrate Type Position
U:Y rRNA (r) LSU/21S/mitochondrial 2819

Publications:

Title Authors Journal Details PubMed Id DOI
Identification of the Saccharomyces cerevisiae RNA:pseudouridine synthase responsible for formation of psi(2819) in 21S mitochondrial ribosomal RNA. Ansmant I, Massenet S, Grosjean H, Motorin Y, Branlant C Nucleic Acids Res [details] 10756195 -
Copyright © Genesilico - All rights reserved
If you have any advice or suggestions for corrections or improvements, please contact: Pietro Boccaletto