Full name: Pseudouridylate synthase 6
Synonym:
GI: 1723726
Orf: YGR169C
COG: COG0564
UniProt: P53294
Structures: | |
Complex:
Enzyme type: pseudouridine synthase
Position of modification - modification: t:31 - Y

Comments:

Mitochondrial and cytoplasmatic tRNA.

Protein sequence:

MSTIKVIEVYTQNGLRKVRPYYNRRSAFVKGRWLGKLLIDVLVSEFKLRPRAYYLDQIRKGTYRLIRDGV PLVPDHLMTTIIKNHDVLETTTHKHEPPVKQWCSQEVEAEDLPGRIAGFNIVFEDESILVIDKPSGIPVH PTGQFYQNTITELLKLHGVDALPCYRLDKITSGLLILAKNSQSAGEIQKSIRSRDMIKIYLARVKGRFPH SELILDNENAAETTFEDTSKVTVEMTPIYSIDPKRQFPVGLSTSKDAITKFYPIRYFSHADETVVACKPI TGRTHQIRIHLARLGHPIVNDSVYCSHITKYPERLKFITQFPRWENQQDLDAEELKVRFQKFVDETKNNC RTMETFCPECHTVDLKDPVLSDLELWLHAWKYEEINGKFKFKTDLPKWAQLDNS

Enzymatic activities:

Reaction Substrate Type Position
U:Y tRNA (t) Met/CAU/prokaryotic cytosol 31
U:Y tRNA (t) Gly/UCC/mitochondrial 31
U:Y tRNA (t) Ile/GAU/mitochondrial 31
U:Y tRNA (t) Leu/UAA/mitochondrial 31
U:Y tRNA (t) Lys/UUU/mitochondrial 31
U:Y tRNA (t)   31
U:Y tRNA (t) Ser/GCU/mitochondrial 31
U:Y tRNA (t) Thr/UAG/mitochondrial 31

Publications:

Title Authors Journal Details PubMed Id DOI
Identification and characterization of the tRNA:Psi 31-synthase (Pus6p) of Saccharomyces cerevisiae. Ansmant I, Motorin Y, Massenet S, Grosjean H, Branlant C J Biol Chem [details] 11406626 -
Copyright © Genesilico - All rights reserved
If you have any advice or suggestions for corrections or improvements, please contact: Pietro Boccaletto