Full name: Bifunctional protein RIB2
Synonym: Rib2
GI: 2501674
Orf: YOL066c
COG: COG0564
UniProt: Q12362
Structures: | |
Complex:
Enzyme type: pseudouridine synthase/deaminase
Position of modification - modification: t:32 - Y

Comments:

Cytoplasmic enzyme (mitochondrial homologue is Pus9). N-terminal part is Rib2p fused protein (not in all organisms).

Protein sequence:

MEDSNNEASDDFNNLLNKEIESAKEVKLRKFANRNNNRNENSSKVKDASGFRLRVIQTDGHKTKKTDPDY EVTIDGPLRKIEPYFFTYKTFCKERWRDRKLVDVFVSEFRDREPSYYSKTIAEGKVYLNDEPANLDTIIR DGDLITHKVHRHEPPVTSKPIDIVFEDEDILVIDKPSSIPVHPTGRYRFNTITKMLERQLGYSVHPCNRL DKPTSGLMFLAKTPLGADRMGDQMKAREVTKEYVARVKGEFPIGIVEVDKPVRSVNPKVALNAVCEMSDE NAKHAKTVFQRVSYDGQTSIVKCKPLTGRTHQIRVHLQYLGFPIANDPIYSNPDIWGPDLGRGGLQNYDD IVLKLDAIGKTNPAESWIHPHSEGEYLLGRQCEECEAEMYTDPGTNDLDLWLHAFRYESLERNSDTQKPL WSYRTKYPEWALEPHRRYMEMAVKEAGKCGPTKTAFSVGAVLVHGTQVLATGYSRELPGNTHAEQCALIK YSQLHPNCPTIVPMGTVLYTTMEPCSFRLSGNEPCCDRILATQGAIGTVFVGVMEPDTFVKNNTSLNKLE SHGVNYIQIPGYEEECTIIAFKGHDNSDDKA

Enzymatic activities:

Reaction Substrate Type Position
U:Y tRNA (t) Asp/GUC/prokaryotic cytosol 32
U:Y tRNA (t) Cys/GCA/prokaryotic cytosol 32
U:Y tRNA (t) Gly/GCC/prokaryotic cytosol 32
U:Y tRNA (t) His/GUG/prokaryotic cytosol 32
U:Y tRNA (t) Leu/UAG/prokaryotic cytosol 32
U:Y tRNA (t) Leu/CAA/prokaryotic cytosol 32
U:Y tRNA (t) Pro/UGG/prokaryotic cytosol 32
U:Y tRNA (t) Ser/IGA/prokaryotic cytosol 32
U:Y tRNA (t) Val/UAC/prokaryotic cytosol 32
U:Y tRNA (t) Val/CAC/prokaryotic cytosol 32
U:Y tRNA (t) Val/IAC/prokaryotic cytosol 32

Publications:

Title Authors Journal Details PubMed Id DOI
Pseudouridylation at position 32 of mitochondrial and cytoplasmic tRNAs requires two distinct enzymes in Saccharomyces cerevisiae. Behm-Ansmant I, Grosjean H, Massenet S, Motorin Y, Branlant C J Biol Chem [details] 15466869 -
Copyright © Genesilico - All rights reserved
If you have any advice or suggestions for corrections or improvements, please contact: Pietro Boccaletto