Full name: tRNA pseudouridine synthase 9, mitochondrial
Synonym:
GI: 6320168
Orf: YDL036c
COG: COG0564
UniProt: Q12069
Structures: | |
Complex:
Enzyme type: pseudouridine synthase
Position of modification - modification: t:32 - Y

Comments:

Mitochondrial enzyme. In the absence of Pus8 works also in cytoplasm.

Protein sequence:

MQRNNRLRNLFTVPVIMARQLKRNALSAGLAFAGNATSNEFDEHLQNEVEREREIQKKKKIKRTQSKKSP DLINKSTFQSRTIGSKKEKHRQLDPEYEIVIDGPLRKIKPYHFTYRTFCKERWRDKKLVDVFISEFRDRE SEYYKRTIENGDVHINDETADLSTVIRNGDLITHQVHRHEPPVTSRPIKVIFEDDNIMVIDKPSGIPVHP TGRYRFNTITKMLQNNLGFVVNPCNRLDRLTSGLMFLAKTPKGADNIGDQLKAREVTKEYVAKVVGEFPE TEVIVEKPLKLIEPRLALNAVCQMDEKGAKHAKTVFNRISYDGKTSIVKCKPLTGRSHQIRVHLQYLGHP IANDPIYSNDEVWGNNLGKGGQADFDIVITKLDEIGKRKPAKSWFHSNGGYGEVLRQEKCSICESDLYTD PGPNDLDLWLHAYLYESTETEEGTEKKKWCYKTEYPEWALRR

Enzymatic activities:

Reaction Substrate Type Position
U:Y tRNA (t) His/GUG/mitochondrial 32
U:Y tRNA (t) Phe/GAA/mitochondrial 32
U:Y tRNA (t) Pro/UGG/mitochondrial 32
U:Y tRNA (t) Ser/UGA/mitochondrial 32
U:Y tRNA (t) Ser/GCU/mitochondrial 32
U:Y tRNA (t) Trp/UCA/mitochondrial 32

Publications:

Title Authors Journal Details PubMed Id DOI
Pseudouridylation at position 32 of mitochondrial and cytoplasmic tRNAs requires two distinct enzymes in Saccharomyces cerevisiae. Behm-Ansmant I, Grosjean H, Massenet S, Motorin Y, Branlant C J Biol Chem [details] 15466869 -
Copyright © Genesilico - All rights reserved
If you have any advice or suggestions for corrections or improvements, please contact: Pietro Boccaletto