Full name: tRNA dihydrouridine synthase A
Synonym: YjbN
GI: 3183570
Orf: yjbN, b4049
COG: COG0042
UniProt: P32695
Structures: | |
Complex:
Enzyme type: dihydrouridine synthase
Position of modification - modification: t:20 - D

Comments:

FMN is the cofactor for the reduction reaction.

Protein sequence:

MPEKTDVHWSGRFSVAPMLDWTDRHCRYFLRLLSRNTLLYTEMVTTGAIIHGKGDYLAYSEEEHPVALQL GGSDPAALAQCAKLAEARGYDEINLNVGCPSDRVQNGMFGACLMGNAQLVADCVKAMRDVVSIPVTVKTR IGIDDQDSYEFLCDFINTVSGKGECEMFIIHARKAWLSGLSPKENREIPPLDYPRVYQLKRDFPHLTMSI NGGIKSLEEAKAHLQHMDGVMVGREAYQNPGILAAVDREIFGSSDTDADPVAVVRAMYPYIERELSQGTY LGHITRHMLGLFQGIPGARQWRRYLSENAHKAGADINVLEHALKLVADKR

Enzymatic activities:

Reaction Substrate Type Position
U:D tRNA (t) Ini/CAU/prokaryotic cytosol 20

Publications:

Title Authors Journal Details PubMed Id DOI
Identification of the tRNA-dihydrouridine synthase family. Bishop AC, Xu J, Johnson RC, Schimmel P, de Crecy-Lagard V J Biol Chem [details] 11983710 -
Molecular determinants of dihydrouridine synthase activity. Savage DF, de Crecy-Lagard V, Bishop AC FEBS Lett [details] 16962594 -
Molecular evolution of dihydrouridine synthases. Kasprzak JM, Czerwoniec A, Bujnicki JM... BMC Bioinformatics [details] 22741570 -

Links:

_Wikipedia_
_PubMed_
Copyright © Genesilico - All rights reserved
If you have any advice or suggestions for corrections or improvements, please contact: Pietro Boccaletto