Modomics - A Database of RNA Modifications

Full name:	Cytoplasmic tRNA 2-thiolation protein 1
Synonym:	Ctu1, Tuc1
GI:	50593215
Orf:	YGL211W
COG:	COG0037
UniProt:	P53088
Structures:	\| \|
Complex:	Nsc2/Ncs6
Enzyme type:	thiolase
Position of modification - modification:	t:34 - cmnm5s2U

Comments:

Both Ncs6 and Ncs2 are necessary for the thiolation of cytoplasmic tRNA. For more information see the entry for yeast Nsc2. High sequence similarities exist between bacterial eukaryal Ncs6 (Tuc1) and bacterial TtcA responsible for the thiolation of C32 in anticodon loop of tRNA (convergent evolution). They might have evolved from a common thiolase precursor. Ncs2 and Ncs6 are down-regulated in a proteasomal dependent fashion in yeast exposed to mild heat stress. This down-regulation influences translation of mRNAs rich in codons decoded by tRNAs thiolated by the Ncs2-Ncs6 complex.

Protein sequence:

MSFTAPSDPVNKPTKVKVSQLCELCHSRKALIRRPKNLSKLCKQCFCLVFETEIHNTIVANNLFQRGEKVAVGASGGKDSTVLAHMLKLLNDRYDYGIEI
VLLSIDEGIIGYRDDSLATVKRNQQQYGLPLEIFSFKDLYDWTMDEIVSVAGIRNSCTYCGVFRRQSLDRGAAKLGISHVVTGHNADDMAETVLMNILRG
DVARLEKSTAIITQSSGSPIKRSKPFKYSYQKEIVLYAHYMKLDYFSTECTYAPEAFRGTAREYMKNLEAVRPSCIIDIIQSGENLALKAKKSNAGKRVV
KFVDGNRCARCGYLSSNNICKACMLLEGLEKSRAQVAIENDTSADGAALKLRALEKLSF

Enzymatic activities:

Reaction	Substrate	Type	Position
U:s2U	tRNA (t)		34
mcm5U:mcm5s2U	tRNA (t)	Gln/3UG/eukaryotic cytosol	34
ncm5U:ncm5s2U	tRNA (t)	Glu/3UC/eukaryotic cytosol	34
ncm5U:ncm5s2U	tRNA (t)	Lys/3UU/eukaryotic cytosol	34
ncm5U:ncm5s2U	tRNA (t)	Gln/3UG/eukaryotic cytosol	34
cm5s2U:mcm5s2U	tRNA (t)	Lys/3UU/unknown	34
cm5s2U:mcm5s2U	tRNA (t)	Glu/3UC/unknown	34

Publications:

Title	Authors	Journal	Details	PubMed Id	DOI
Ubiquitin-related modifier Urm1 acts as a sulphur carrier in thiolation of eukaryotic transfer RNA.	Leidel S, Pedrioli PG, Bucher T, Brost R, Costanzo M, Schmidt A, Aebersold R, Boone C, Hofmann K, Peter M	Nature	[details]	19145231	-
A conserved modified wobble nucleoside (mcm5s2U) in lysyl-tRNA is required for viability in yeast.	Bjork GR, Huang B, Persson OP, Bystrom AS	RNA	[details]	17592039	-
Mechanistic characterization of the sulfur-relay system for eukaryotic 2-thiouridine biogenesis at tRNA wobble positions.	Noma A, Sakaguchi Y, Suzuki T	Nucleic Acids Res	[details]	19151091	-
A genome-wide screen identifies genes required for formation of the wobble nucleoside 5-methoxycarbonylmethyl-2-thiouridine in Saccharomyces cerevisiae.	Huang B, Lu J, Bystrom AS	RNA	[details]	18755837	-
Thio-modification of yeast cytosolic tRNA requires a ubiquitin-related system that resembles bacterial sulfur transfer systems.	Nakai Y, Nakai M, Hayashi H	J Biol Chem	[details]	18664566	-
Protein degradation and dynamic tRNA thiolation fine-tune translation at elevated temperatures.	Tyagi K, Pedrioli PG...	Nucleic Acids Res	[details]	25870413	-

Links:

_PubMed_

_PubMed_