Full name: tRNA dihydrouridine synthase B
Synonym: YhdG
GI: 78100051
Orf: yhdG,b3260
COG: COG0042
UniProt: P0ABT5
Structures: | |
Complex:
Enzyme type: dihydrouridine synthase
Position of modification - modification: t:16 - D
t:20a - D
t:20 - D
t:17 - D

Comments:

DusB and DusC enzymes together introduce all D at positions 16, 17, 20, and 20a in all tRNAs, but it is not known which of them modifies which base and in which tRNA. FMN is the cofactor for the reduction reaction.

Protein sequence:

MRIGQYQLRNRLIAAPMAGITDRPFRTLCYEMGAGLTVSEMMSSNPQVWESDKSRLRMVHIDEPGIRTVQ IAGSDPKEMADAARINVESGAQIIDINMGCPAKKVNRKLAGSALLQYPDVVKSILTEVVNAVDVPVTLKI RTGWAPEHRNCEEIAQLAEDCGIQALTIHGRTRACLFNGEAEYDSIRAVKQKVSIPVIANGDITDPLKAR AVLDYTGADALMIGRAAQGRPWIFREIQHYLDTGELLPPLPLAEVKRLLCAHVRELHDFYGPAKGYRIAR KHVSWYLQEHAPNDQFRRTFNAIEDASEQLEALEAYFENFA

Enzymatic activities:

Reaction Substrate Type Position
U:D tRNA (t)   16
U:D tRNA (t)   20
U:D tRNA (t)   20a
U:D tRNA (t)   17

Publications:

Title Authors Journal Details PubMed Id DOI
Identification of the tRNA-dihydrouridine synthase family. Bishop AC, Xu J, Johnson RC, Schimmel P, de Crecy-Lagard V J Biol Chem [details] 11983710 -
Molecular determinants of dihydrouridine synthase activity. Savage DF, de Crecy-Lagard V, Bishop AC FEBS Lett [details] 16962594 -
Molecular evolution of dihydrouridine synthases. Kasprzak JM, Czerwoniec A, Bujnicki JM... BMC Bioinformatics [details] 22741570 -

Links:

_Wikipedia_
_PubMed_
Copyright © Genesilico - All rights reserved
If you have any advice or suggestions for corrections or improvements, please contact: Pietro Boccaletto