Modomics - A Database of RNA Modifications

Full name: tRNA guanosine-2′-O-methyltransferase TRM11
Synonym:
GI: 74655048
Orf: YOL124C
COG: COG1041
UniProt: Q12463
Structures: | |
Complex:
Enzyme type: methyltransferase
Position of modification - modification: t:10 - m2G

Comments:

AdoMet is the methyl group donor. Heterodimer composed of two unrelated subunits: Trm11p (catalytic subunit) and Trm112p (essential cofactor). Contains a THUMP domain.

Protein sequence:

MKKYLLYMVQVHLNFRRAELESLADLYNLSIDFSQYDANSPFFIVELENDQQAKDWIKRSILTRGIYEYWGQGTTLDELHKDIQRQSNFEQDLQLKFKHS
TFKFEFECYKGNSKAKRVEQIETFRYLGFEGKIDMKHPQEVFTVIEEYTPISENVGGKTPTRIYFGRQVQMSNRSAMEKYDLKKRPYKGTTSFEAELSLV
SANIAQVKPGTIMYDPFAGTGSFLVAGGHFGSLVIGSDIDGRMIRGKGAQVNISANFKKYGESSQFLDVLTMDFTNNALRNNLVIDTILCDPPYGIRESI
KVLGAKDPERFLGKEDMEIDGEKAYLRRDYIPTKKPYALDSLLDDLLQYSSERLPIGGRLAFWMPTANDANIETIVPMHENLELKYNCVQEFNKWSRRLL
VYINRGSTFNGSSNHGIKRSKDNFRERYFNNFN

Enzymatic activities:

Reaction Substrate Type Position
G:m2G tRNA (t) Arg/ACU/prokaryotic cytosol 10
G:m2G tRNA (t) Arg/ICG/prokaryotic cytosol 10
G:m2G tRNA (t) Asn/GUU/prokaryotic cytosol 10
G:m2G tRNA (t) Ile/IAU/prokaryotic cytosol 10
G:m2G tRNA (t) Ile/UAU/prokaryotic cytosol 10
G:m2G tRNA (t) Leu/UAG/prokaryotic cytosol 10
G:m2G tRNA (t) Leu/CAA/prokaryotic cytosol 10
G:m2G tRNA (t) Leu/UAA/prokaryotic cytosol 10
G:m2G tRNA (t) Lys/CUU/prokaryotic cytosol 10
G:m2G tRNA (t) Met/CAU/prokaryotic cytosol 10
G:m2G tRNA (t) Phe/GAA/prokaryotic cytosol 10
G:m2G tRNA (t) Thr/IGU/prokaryotic cytosol 10
G:m2G tRNA (t) Trp/CCA/prokaryotic cytosol 10
G:m2G tRNA (t) Tyr/GUA/prokaryotic cytosol 10
G:m2G tRNA (t) Val/CAC/prokaryotic cytosol 10
G:m2G tRNA (t) Val/UAC/prokaryotic cytosol 10
G:m2G tRNA (t)   10

Publications:

Title Authors Journal Details PubMed Id DOI
Trm11p and Trm112p are both required for the formation of 2-methylguanosine at position 10 in yeast tRNA. Purushothaman SK, Bujnicki JM, Grosjean H, Lapeyre B Mol Cell Biol [details] 15899842 -

Copyright © Genesilico - All rights reserved
If you have any advice or suggestions for corrections or improvements, please contact: Andrea Cappannini - lp.vog.bcmii@ininnappaca