Modomics - A Database of RNA Modifications

Full name:	tRNA guanosine-2′-O-methyltransferase TRM11
Synonym:
GI:	74655048
Orf:	YOL124C
COG:	COG1041
UniProt:	Q12463
Structures:	\| \|
Complex:
Enzyme type:	methyltransferase
Position of modification - modification:	t:10 - m2G

Comments:

AdoMet is the methyl group donor. Heterodimer composed of two unrelated subunits: Trm11p (catalytic subunit) and Trm112p (essential cofactor). Contains a THUMP domain.

Protein sequence:

MKKYLLYMVQVHLNFRRAELESLADLYNLSIDFSQYDANSPFFIVELENDQQAKDWIKRSILTRGIYEYWGQGTTLDELHKDIQRQSNFEQDLQLKFKHS
TFKFEFECYKGNSKAKRVEQIETFRYLGFEGKIDMKHPQEVFTVIEEYTPISENVGGKTPTRIYFGRQVQMSNRSAMEKYDLKKRPYKGTTSFEAELSLV
SANIAQVKPGTIMYDPFAGTGSFLVAGGHFGSLVIGSDIDGRMIRGKGAQVNISANFKKYGESSQFLDVLTMDFTNNALRNNLVIDTILCDPPYGIRESI
KVLGAKDPERFLGKEDMEIDGEKAYLRRDYIPTKKPYALDSLLDDLLQYSSERLPIGGRLAFWMPTANDANIETIVPMHENLELKYNCVQEFNKWSRRLL
VYINRGSTFNGSSNHGIKRSKDNFRERYFNNFN

Enzymatic activities:

Reaction	Substrate	Type	Position
G:m2G	tRNA (t)	Arg/ACU/prokaryotic cytosol	10
G:m2G	tRNA (t)	Arg/ICG/prokaryotic cytosol	10
G:m2G	tRNA (t)	Asn/GUU/prokaryotic cytosol	10
G:m2G	tRNA (t)	Ile/IAU/prokaryotic cytosol	10
G:m2G	tRNA (t)	Ile/UAU/prokaryotic cytosol	10
G:m2G	tRNA (t)	Leu/UAG/prokaryotic cytosol	10
G:m2G	tRNA (t)	Leu/CAA/prokaryotic cytosol	10
G:m2G	tRNA (t)	Leu/UAA/prokaryotic cytosol	10
G:m2G	tRNA (t)	Lys/CUU/prokaryotic cytosol	10
G:m2G	tRNA (t)	Met/CAU/prokaryotic cytosol	10
G:m2G	tRNA (t)	Phe/GAA/prokaryotic cytosol	10
G:m2G	tRNA (t)	Thr/IGU/prokaryotic cytosol	10
G:m2G	tRNA (t)	Trp/CCA/prokaryotic cytosol	10
G:m2G	tRNA (t)	Tyr/GUA/prokaryotic cytosol	10
G:m2G	tRNA (t)	Val/CAC/prokaryotic cytosol	10
G:m2G	tRNA (t)	Val/UAC/prokaryotic cytosol	10
G:m2G	tRNA (t)		10

Publications:

Title	Authors	Journal	Details	PubMed Id	DOI
Trm11p and Trm112p are both required for the formation of 2-methylguanosine at position 10 in yeast tRNA.	Purushothaman SK, Bujnicki JM, Grosjean H, Lapeyre B	Mol Cell Biol	[details]	15899842	-