Full name: Multifunctional methyltransferase subunit TRM112
Synonym:
GI: 1730682
Orf: YNR046W
COG: COG2835
UniProt: P53738
Structures: | 5CM2 |
Complex:

Comments:

Trm112p makes complexes with Ttm11p, Trm9p and Mtq2c.

Protein sequence:

MKFLTTNFLKCSVKACDTSNDNFPLQYDGSKCQLVQDESIEFNPEFLLNIVDRVDWPAVLTVAAELGNNA LPPTKPSFPSSIQELTDDDMAILNDLHTLLLQTSIAEGEMKCRNCGHIYYIKNGIPNLLLPPHLV

Publications:

Title Authors Journal Details PubMed Id DOI
Trm11p and Trm112p are both required for the formation of 2-methylguanosine at position 10 in yeast tRNA. Purushothaman SK, Bujnicki JM, Grosjean H, Lapeyre B Mol Cell Biol [details] 15899842 -
Unexpected accumulation of ncm(5)U and ncm(5)S(2) (U) in a trm9 mutant suggests an additional step in the synthesis of mcm(5)U and mcm(5)S(2)U. Chen C, Huang B, Anderson JT, Bystrom AS PLoS One [details] 21687733 -
Trm112p is a 15-kDa zinc finger protein essential for the activity of two tRNA and one protein methyltransferases in yeast. Mazauric MH, Dirick L, Purushothaman SK, Bjork GR, Lapeyre B J Biol Chem [details] 20400505 -
Trm112 Is Required for Bud23-Mediated Methylation of the 18S rRNA at Position G1575. Figaro S, Wacheul L, Schillewaert S, Graille M, Huvelle E, Mongeard R, Zorbas C, Lafontaine DL, Heurgue-Hamard V Mol Cell Biol [details] 22493060 -
The methyltransferase adaptor protein Trm112 is involved in biogenesis of both ribosomal subunits. Sardana R, Johnson AW... Mol Biol Cell [details] 22956767 -
Structural and functional studies of Bud23-Trm112 reveal 18S rRNA N7-G1575 methylation occurs on late 40S precursor ribosomes. Letoquart J, Huvelle E, Wacheul L, Bourgeois G, Zorbas C, Graille M, Heurgue-Hamard V, Lafontaine DL... Proc Natl Acad Sci U S A [details] 25489090 -
Insights into molecular plasticity in protein complexes from Trm9-Trm112 tRNA modifying enzyme crystal structure. Letoquart J, Tran NV, Caroline V, Aleksandrov A, Lazar N, van Tilbeurgh H, Liger D, Graille M... Nucleic Acids Res [details] 26438534 -
Copyright © Genesilico - All rights reserved
If you have any advice or suggestions for corrections or improvements, please contact: Pietro Boccaletto