Full name: tRNA (adenine(22)-N(1))-methyltransferase
Synonym:
GI: 332278123
Orf: YqfN
COG:
UniProt: P54471
Structures: | |
Complex:
Enzyme type: methyltransferase
Position of modification - modification: t:22 - m1A

Comments:



Protein sequence:

MADIGSDHAYLPCYAVLNHKASGAIAGEITDGPFLSAKRQVEKSGLNSHISVRQGDGLEVIKKGEADAIT IAGMGGALIAHILEAGKDKLTGKERLILQPNIHAVHIREWLYKERYALIDEVILEEDGKCYEVLVAEAGD RDAAYDGISLSAGMLVGPFLAKEKNAVFLKKWTQELQHTQSIYEQISQAADTEQNKQKLKELADRMELLK EVIDHG

Enzymatic activities:

Reaction Substrate Type Position
A:m1A tRNA (t)   22

Publications:

Title Authors Journal Details PubMed Id DOI
The YqfN protein of Bacillus subtilis is the tRNA: m1A22 methyltransferase (TrmK). Roovers M, Kaminska KH, Tkaczuk KL, Gigot D, Droogmans L, Bujnicki JM Nucleic Acids Res [details] 18420655 -
Copyright © Genesilico - All rights reserved
If you have any advice or suggestions for corrections or improvements, please contact: Pietro Boccaletto