Modomics - A Database of RNA Modifications

Full name:	tRNA (adenosine(37)-N6)-dimethylallyltransferase
Synonym:	TrpX
GI:	127087
Orf:	b4171
COG:	COG0324
UniProt:	P16384
Structures:	\| 3FOZ \| 2ZM5 \| 2ZXU \|
Complex:
Enzyme type:	dimethylallyltransferase
Position of modification - modification:	t:37 - i6A

Comments:

Bacterial MiaA, initially called dimethylallyl diphosphate:tRNA dimethylallyltransferase, belongs to the IPP transferase superfamily including eukaryotic Mod5. It catalyzes the transfer of isopentenyl group on N6 of A37 in most A36A37-containing tRNA. Isopentenyl originates from ispentenyl-pyrophosphate (IPP). MiaA-like proteins are totally absent in Archaea.

Protein sequence:

MSDISKASLPKAIFLMGPTASGKTALAIELRKILPVELISVDSALIYKGMDIGTAKPNAEELLAAPHRLLDIRDPSQAYSAADFRRDALAEMADITAAGR
IPLLVGGTMLYFKALLEGLSPLPSADPEVRARIEQQAAEQGWESLHRQLQEVDPVAAARIHPNDPQRLSRALEVFFISGKTLTELTQTSGDALPYQVHQF
AIAPASRELLHQRIEQRFHQMLASGFEAEVRALFARGDLHTDLPSIRCVGYRQMWSYLEGEISYDEMVYRGVCATRQLAKRQITWLRGWEGVHWLDSEKP
EQARDEVLQVVGAIAG

Enzymatic activities:

Reaction	Substrate	Type	Position
A:i6A	tRNA (t)		37

Publications:

Title	Authors	Journal	Details	PubMed Id	DOI
Molecular cloning of the Escherichia coli miaA gene involved in the formation of delta 2-isopentenyl adenosine in tRNA.	Caillet J, Droogmans L	J Bacteriol	[details]	3045085	-
Structural bioinformatics analysis of enzymes involved in the biosynthesis pathway of the hypermodified nucleoside ms(2)io(6)A37 in tRNA.	Kaminska KH, Baraniak U, Boniecki M, Nowaczyk K, Czerwoniec A, Bujnicki JM	Proteins	[details]	17910062	-
Snapshots of dynamics in synthesizing N(6)-isopentenyladenosine at the tRNA anticodon.	Chimnaronk S, Forouhar F, Sakai J, Yao M, Tron CM, Atta M, Fontecave M, Hunt JF, Tanaka I	Biochemistry	[details]	19435325	-
RNA-protein mutually induced fit: structure of Escherichia coli isopentenyl-tRNA transferase in complex with tRNA(Phe).	Seif E, Hallberg BM	J Biol Chem	[details]	19158097	-
Escherichia coli dimethylallyl diphosphate:tRNA dimethylallyltransferase: a binding mechanism for recombinant enzyme.	Moore JA, Poulter CD	Biochemistry	[details]	9012675	-

Links:

_PubMed_

_PubMed_