Full name: H/ACA ribonucleoprotein complex subunit 1
Synonym:
GI: 120941
Orf: YHR089C
COG: COG3277
UniProt: P28007
Structures: | 3UAI | 3U28 |
Complex: H/ACA RNP

Comments:

Essential subunit of the nucleolar Box H/ACA ribonucleoprotein particles (RNP) involved in 2’-O-methylation of several cellular RNA (mainly rRNA and snRNA), including intron-containing pre-RNA in yeast. Gar1 is distinguished from the assembly factor Naf1 by containing a C-terminal extension that controls substrate turnover and the Gar1-Naf1 exchange during H/ACA RNP maturation.

Protein sequence:

MSFRGGNRGGRGGFRGGFRGGRTGSARSFQQGPPDTVLEMGAFLHPCEGDIVCRSINTKIPYFNAPIYLE NKTQVGKVDEILGPLNEVFFTIKCGDGVQATSFKEGDKFYIAADKLLPIERFLPKPKVVGPPKPKNKKKR SGAPGGRGGASMGRGGSRGGFRGGRGGSSFRGGRGGSSFRGGSRGGSFRGGSRGGSRGGFRGGRR

Publications:

Title Authors Journal Details PubMed Id DOI
GAR1 is an essential small nucleolar RNP protein required for pre-rRNA processing in yeast. Girard JP, Lehtonen H, Caizergues-Ferrer M, Amalric F, Tollervey D, Lapeyre B EMBO J [details] 1531632 -
Reconstitution and structural analysis of the yeast box H/ACA RNA-guided pseudouridine synthase. Li S, Duan J, Li D, Yang B, Dong M, Ye K Genes Dev [details] 22085967 -
Structure of the Shq1-Cbf5-Nop10-Gar1 complex and implications for H/ACA RNP biogenesis and dyskeratosis congenita. Li S, Duan J, Li D, Ma S, Ye K EMBO J [details] 22117216 -
The box H/ACA RNP assembly factor Naf1p contains a domain homologous to Gar1p mediating its interaction with Cbf5p. Leulliot N, Godin KS, Hoareau-Aveilla C, Quevillon-Cheruel S, Varani G, Henry Y, Van Tilbeurgh H... J Mol Biol [details] 17612558 -

Links:

_PubMed_
_SGD_
_Wikipedia - Small nucleolar RNA_
Copyright © Genesilico - All rights reserved
If you have any advice or suggestions for corrections or improvements, please contact: Pietro Boccaletto