Full name: tRNA epoxyqueuosine(34) reductase
Synonym: YjeS
GI: 16131988
Orf:
COG: COG1600
UniProt: P39288
Structures: | |
Complex:
Enzyme type: oxidoreductase
Position of modification - modification: t:34 - QtRNA

Comments:

Vitamine B12 dependent.

Protein sequence:

MSEPLDLNQLAQKIKQWGLELGFQQVGITDTDLSESEPKLQAWLDKQYHGEMDWMARHGMLRARPHELLP GTLRVISVRMNYLPANAAFASTLKNPKLGYVSRYALGRDYHKLLRNRLKKLGEMIQQHCVSLNFRPFVDS APILERPLAEKAGLGWTGKHSLILNREAGSFFFLGELLVDIPLPVDQPVEEGCGKCVACMTICPTGAIVE PYTVDARRCISYLTIELEGAIPEELRPLMGNRIYGCDDCQLICPWNRYSQLTTEEDFSPRKPLHAPELIE LFAWSEEKFLKVTEGSAIRRIGHLRWLRNIAVALGNAPWDETILTALESRKGEHPLLDEHIAWAIAQQIE RRNACIVEVQLPKKQRLVRVIEKGLPRDA

Enzymatic activities:

Reaction Substrate Type Position
oQtRNA:QtRNA tRNA (t)   34

Publications:

Title Authors Journal Details PubMed Id DOI
New function of vitamin B12: cobamide-dependent reduction of epoxyqueuosine to queuosine in tRNAs of Escherichia coli and Salmonella typhimurium. Frey B, McCloskey J, Kersten W, Kersten H J Bacteriol [details] 3129401 -
Structure and organization of Escherichia coli genes involved in biosynthesis of the deazaguanine derivative queuine, a nutrient factor for eukaryotes. Reuter K, Slany R, Ullrich F, Kersten H J Bacteriol [details] 1706703 -
Discovery of epoxyqueuosine (oQ) reductase reveals parallels between halorespiration and tRNA modification. Miles ZD, McCarty RM, Molnar G, Bandarian V Proc Natl Acad Sci U S A [details] 21502530 -

Links:

_EcoCyc_
Copyright © Genesilico - All rights reserved
If you have any advice or suggestions for corrections or improvements, please contact: Pietro Boccaletto