Full name: tRNA-specific adenosine deaminase subunit TAD3
Synonym: ADAT3
GI: 23822264
Orf: YLR316C
COG: COG0590
UniProt: Q9URQ3
Structures: | |
Complex: Tad2/3
Enzyme type: deaminase
Position of modification - modification: t:34 - I

Comments:

Tad2 is a part of the heterodimeric deaminase Tad2/3 (ADAT2/3) which is responsible for A:I reaction in tRNA position 34. Zinc enzyme.

Protein sequence:

MVKKVNNPLKIDYQNGIIENRLLQIRNFKDVNTPKLINVWSIRIDPRDSKKVIELIRNDFQKNDPVSLRH LKRIRKDIETSTLEVVLCSKEYICDEGEINNKLKSIWVGTKKYELSDDIEVPEFAPSTKELNNAWSVKYW PLIWNGNPNDQILNDYKIDMQEVRNELSRASTLSVKMATAGKQFPMVSVFVDPSRKKDKVVAEDGRNCEN SLPIDHSVMVGIRAVGERLREGVDEDANSYLCLDYDVYLTHEPCSMCSMALIHSRVRRVVFLTEMQRTGS LKLTSGDGYCMNDNKQLNSTYEAFQWIGEEYPVGQVDRDVCC

Enzymatic activities:

Reaction Substrate Type Position
A:I tRNA (t) Pro/IGG/cytosolic 34
A:I tRNA (t) Val/IAC/prokaryotic cytosol 34
A:I tRNA (t) Thr/IGU/prokaryotic cytosol 34
A:I tRNA (t) Ser/IGA/prokaryotic cytosol 34
A:I tRNA (t) Ile/IAU/prokaryotic cytosol 34
A:I tRNA (t) Arg/ICG/prokaryotic cytosol 34
A:I tRNA (t) Ala/IGC/prokaryotic cytosol 34

Publications:

Title Authors Journal Details PubMed Id DOI
An adenosine deaminase that generates inosine at the wobble position of tRNAs. Gerber AP, Keller W Science [details] 10550050 -
A-to-I and C-to-U editing within transfer RNAs. Su AA, Randau L Biochemistry (Mosc) [details] 22022967 -
Determinants of tRNA editing and modification: Avoiding conundrums, affecting function. Paris Z, Fleming IM, Alfonzo JD Semin Cell Dev Biol [details] 22024020 -

Links:

_Wikipedia_-_RNA_editing_
_Wikipedia_-_Deamination_
_SGD_
Copyright © Genesilico - All rights reserved
If you have any advice or suggestions for corrections or improvements, please contact: Pietro Boccaletto