Modomics - A Database of RNA Modifications

Full name:	Ribosomal RNA small subunit methyltransferase I
Synonym:	yraL
GI:	1789535
Orf:
COG:	COG0313
UniProt:	P67087
Structures:	\| \|
Complex:
Enzyme type:	methyltransferase
Position of modification - modification:	s:1403(1403) - m4Cm

Comments:

RsmI catalyzes 2’-O-ribose methylation of cytidine C1402 (Cm) in helix 44 within the decoding center of 16S rRNA. AdoMet is the methyl group donor and the 30S subunit (not the naked 16 rRNA) is the substrate. This enzyme is conserved in almost all species of bacteria. Together with methyltransferase TrmH, it allows the formation of very conserved m4Cm. Notice, in yeast, human and Arabidopsis the ribose methylation of equivalent C in 18S rRNA is catalyzed by a snoRNA-guided methylation machinery.

Protein sequence:

MKQHQSADNSQGQLYIVPTPIGNLADITQRALEVLQAVDLIAAEDTRHTGLLLQHFGINARLFALHDHNEQQKAETLLAKLQEGQNIALVSDAGTPLIND
PGYHLVRTCREAGIRVVPLPGPCAAITALSAAGLPSDRFCYEGFLPAKSKGRRDALKAIEAEPRTLIFYESTHRLLDSLEDIVAVLGESRYVVLARELTK
TWETIHGAPVGELLAWVKEDENRRKGEMVLIVEGHKAQEEDLPADALRTLALLQAELPLKKAAALAAEIHGVKKNALYKYALEQQG

Enzymatic activities:

Reaction	Substrate	Type	Position
C:Cm	rRNA (r)	SSU/16S/prokaryotic cytosol	1402
m4C:m4Cm	rRNA (r)	SSU/16S/prokaryotic cytosol	1402

Publications:

Title	Authors	Journal	Details	PubMed Id	DOI
Fine-tuning of the ribosomal decoding center by conserved methyl-modifications in the Escherichia coli 16S rRNA.	Kimura S, Suzuki T	Nucleic Acids Res	[details]	19965768	-
Influence of phylogeny on posttranscriptional modification of rRNA in thermophilic prokaryotes: the complete modification map of 16S rRNA of Thermus thermophilus.	Guymon R, Pomerantz SC, Crain PF, McCloskey JA	Biochemistry	[details]	16605256	-
Purification, crystallization and preliminary crystallographic analysis of the 16S rRNA methyltransferase RsmI from Escherichia coli.	Zhao M, Wang L, Zhang H, Dong Y, Gong Y, Zhang L, Wang J...	Acta Crystallogr F Struct Biol Commun	[details]	25195904	-