MKQHQSADNSQGQLYIVPTPIGNLADITQRALEVLQAVDLIAAEDTRHTGLLLQHFGINARLFALHDHNEQQKAETLLAKLQEGQNIALVSDAGTPLIND PGYHLVRTCREAGIRVVPLPGPCAAITALSAAGLPSDRFCYEGFLPAKSKGRRDALKAIEAEPRTLIFYESTHRLLDSLEDIVAVLGESRYVVLARELTK TWETIHGAPVGELLAWVKEDENRRKGEMVLIVEGHKAQEEDLPADALRTLALLQAELPLKKAAALAAEIHGVKKNALYKYALEQQG
Reaction | Substrate | Type | Position |
---|---|---|---|
C:Cm | rRNA (r) | SSU/16S/prokaryotic cytosol | 1402 |
m4C:m4Cm | rRNA (r) | SSU/16S/prokaryotic cytosol | 1402 |
Title | Authors | Journal | Details | ||
---|---|---|---|---|---|
Fine-tuning of the ribosomal decoding center by conserved methyl-modifications in the Escherichia coli 16S rRNA. | Kimura S, Suzuki T | Nucleic Acids Res | [details] | 19965768 | - |
Influence of phylogeny on posttranscriptional modification of rRNA in thermophilic prokaryotes: the complete modification map of 16S rRNA of Thermus thermophilus. | Guymon R, Pomerantz SC, Crain PF, McCloskey JA | Biochemistry | [details] | 16605256 | - |
Purification, crystallization and preliminary crystallographic analysis of the 16S rRNA methyltransferase RsmI from Escherichia coli. | Zhao M, Wang L, Zhang H, Dong Y, Gong Y, Zhang L, Wang J... | Acta Crystallogr F Struct Biol Commun | [details] | 25195904 | - |