Full name: tRNA-specific adenosine deaminase 1
Synonym: ADAT1, YGL243W
GI: 1723979
Orf: HRA400
COG: COG0590
UniProt: P53065
Structures: | |
Complex:
Enzyme type: deaminase
Position of modification - modification: t:37 - m1I

Comments:

Tad1 (ADAT1) catalyze the A-to-I deamination which is the first step in m1I synthesis in tRNA position 37. Zinc enzyme.

Protein sequence:

MVSCQGTRPCIVNLLTMPSEDKLGEEISTRVINEYSKLKSACRPIIRPSGIREWTILAGVAAINRDGGAN KIEILSIATGVKALPDSELQRSEGKILHDCHAEILALRGANTVLLNRIQNYNPSSGDKFIQHNDEIPARF NLKENWELALYISRLPCGDASMSFLNDNCKNDDFIKIEDSDEFQYVDRSVKTILRGRLNFNRRNVVRTKP GRYDSNITLSKSCSDKLLMKQRSSVLNCLNYELFEKPVFLKYIVIPNLEDETKHHLEQSFHTRLPNLDNE IKFLNCLKPFYDDKLDEEDVPGLMCSVKLFMDDFSTEEAILNGVRNGFYTKSSKPLRKHCQSQVSRFAQW ELFKKIRPEYEGISYLEFKSRQKKRSQLIIAIKNILSPDGWIPTRTDDVK

Enzymatic activities:

Reaction Substrate Type Position
A:I tRNA (t) Ala/IGC/prokaryotic cytosol 37

Publications:

Title Authors Journal Details PubMed Id DOI
Tad1p, a yeast tRNA-specific adenosine deaminase, is related to the mammalian pre-mRNA editing enzymes ADAR1 and ADAR2. Gerber A, Grosjean H, Melcher T, Keller W EMBO J [details] 9707437 -
A-to-I and C-to-U editing within transfer RNAs. Su AA, Randau L Biochemistry (Mosc) [details] 22022967 -
Determinants of tRNA editing and modification: Avoiding conundrums, affecting function. Paris Z, Fleming IM, Alfonzo JD Semin Cell Dev Biol [details] 22024020 -

Links:

_Wikipedia_-_RNA_editing_
_Wikipedia_-_Deamination_
_SGD_
Copyright © Genesilico - All rights reserved
If you have any advice or suggestions for corrections or improvements, please contact: Pietro Boccaletto