Full name: Methylenetetrahydrofolate-tRNA-(uracil-54-)-methyltransferase TrmFO
Synonym:
GI: 55981411
Orf:
COG: COG1206
UniProt: Q5SID2
Structures: | 3G5Q | 3G5R | 3G5S |
Complex:
Enzyme type: methyltransferase
Position of modification - modification: t:54 - m5s2U

Comments:

Homologue of B. subtilis TrmFO responsible for m5U formation in tRNA position 54. In T. thermophilus m5U in position 54 is further processed to m5s2U. Crystal structures of Thermus thermophilus TrmFO in its free form, tetrahydrofolate (THF)-bound form, and glutathione-bound form at 2.1-, 1.6-, and 1.05-A resolutions were solved. The activity was tested in vitro on tRNAIle transcript.

Protein sequence:

MERVNVVGAGLAGSEAAWTLLRLGVPVRLFEMRPKRMTPAHGTDRFAEIVCSNSLGGEGETNAKGLLQAE MRRAGSLVMEAADLARVPAGGALAVDREEFSGYITERLTGHPLLEVVREEVREIPPGITVLATGPLTSEA LAEALKRRFGDHFLAYYDAASPIVLYESIDLTKCFRAGRYGQSADYLNCPMTEEEYRRFHQALLEAQRHT PHDWEKLEFFEACVPVEELARRGYQTLLFGPMKPVGLVDPRTGKEPFAVVQLRQEDKAGRMWSLVGFQTG LKWPEQKRLIQMIPGLENAEIVRYGVMHRNTYLNAPRLLGETLEFREAEGLYAAGVLAGVEGYLESAATG FLAGLNAARKALGLPPVAPPEESMLGGLVRYLATANPEGFQPMYANWGLVPPVEGRMGKKEKRQAMYRRG LEAFSAWLSGLNPPLPRPEAALV

Enzymatic activities:

Reaction Substrate Type Position
U:m5U tRNA (t) Ile/GAU/prokaryotic cytosol 54

Publications:

Title Authors Journal Details PubMed Id DOI
Atomic structure of a folate/FAD-dependent tRNA T54 methyltransferase. Nishimasu H, Ishitani R, Yamashita K, Iwashita C, Hirata A, Hori H, Nureki O Proc Natl Acad Sci U S A [details] 19416846 -
The tRNA recognition mechanism of folate/FAD-dependent tRNA methyltransferase (TrmFO). Yamagami R, Yamashita K, Nishimasu H, Tomikawa C, Ochi A, Iwashita C, Hirata A, Ishitani R, Nureki O, Hori H... J Biol Chem [details] 23095745 -
Copyright © Genesilico - All rights reserved
If you have any advice or suggestions for corrections or improvements, please contact: Pietro Boccaletto