Full name: tRNA (uracil(54)-C(5))-methyltransferase
Synonym: PYRAB10780
GI: 14521283
Orf: PAB0719
COG: COG2265
UniProt: Q9UZR7
Structures: | 2VS1 | 2JJQ |
Complex:
Enzyme type: methyltransferase
Position of modification - modification: t:54 - m5U

Comments:

The activity was tested in vitro on yeast tRNAAsp transcript

Protein sequence:

MRGVIRKLNDDGFGVLKGILVPFSAPGDEIIVERVERVKKRRVASQWKLVRSSPLRVGPRCKAFGKCGGC TLQHLNYDYQLEFKRKKLKRILGFEVEVVPSPKIFGHRNRIDLAITKDGIGFRERGKWWKIVDIDECPVF GKTSREAIERLKEFIEEEKISVWNIKKDEGFLRYMVLREGKFTEEVMVNFVTKEGNLPDPTNYFDFDSIY WSVNRSKSDVSYGDIERFWGKEFIRERLDDVDYLIHPNSFFQTNSYQAVNLVRKVSELVEGEKILDMYSG VGTFGIYLAKRGFNVKGFDSNEFAIEMARRNVEINNVDAEFEVASDREVSVKGFDTVIVDPPRAGLHPRL VKRLNREKPGVIVYVSCNPETFARDVKMLDYRIDEIVALDMFPHTPHVELVAKLV

Enzymatic activities:

Reaction Substrate Type Position
U:m5U tRNA (t) Asp/GUC/prokaryotic cytosol 54

Publications:

Title Authors Journal Details PubMed Id DOI
The crystal structure of Pyrococcus abyssi tRNA (uracil-54, C5)-methyltransferase provides insights into its tRNA specificity. Walbott H, Leulliot N, Grosjean H, Golinelli-Pimpaneau B Nucleic Acids Res [details] 18653523 -
Acquisition of a bacterial RumA-type tRNA(uracil-54, C5)-methyltransferase by Archaea through an ancient horizontal gene transfer. Urbonavicius J, Auxilien S, Walbott H, Trachana K, Golinelli-Pimpaneau B, Brochier-Armanet C, Grosjean H Mol Microbiol [details] 18069966 -

Links:

_PubMed_
Copyright © Genesilico - All rights reserved
If you have any advice or suggestions for corrections or improvements, please contact: Pietro Boccaletto