Full name: 23S rRNA (uracil(747)-C(5))-methyltransferase
Synonym: PYRAB11450
GI: 50401700
Orf: PAB0760
COG: COG2265
UniProt: Q9UZK1
Structures: | |
Complex:
Enzyme type: methyltransferase
Position of modification - modification: l:887(747) - m5U

Comments:

The gene coding for this enzyme appears in Thermococcales (Archaea) by lateral gene transfer of a bacterial gene coding for a RlmD (RumA-like). Once in Archaea, it duplicates into two paralogs (PAB0719 (TrmU54) and PAB0760). PAB0760 behaves like a bacterial RlmC (E. coli RumB) catalyzing in vitro the site-specific formation of m5U at position 747 (E. coli numbering) in helix 35 of domain II of P. abyssi 23S rRNA. A transcript of rRNA fragment encompassing helix 33-35 was used as substrate in an in vitro test system.

Protein sequence:

MRGIIKGVSNDGLGVLGEVLVPFAYPGDVVEVISTRERFGRTIARDFKLVKSSPIRVPGKCRYFGRCGGC LWQGLKYREQLKLKEEIFKRVTGVEAEIKGSPRIWFFRNISNFIVTVNGIGFKEFGMPRTVVSVDECPVF SERTKLYIRAMKRFLRETGLNPWNWKNGDVHYLQVREGKFTGEVMINVIAHIPPSGREELTEAFGFADSV YWSLKRDKRDDPKGIPTLIKGNEFIRESIEGLVYLIHPSTFFQTNSYALPILLKAVESFAEGSKVLDLYS GVGTFSLYLAKKGFEVTGVEVNEESVRVAKKSAEVNSLDVSFIPGRAEDAKLKGYETLIVDPPRKGLKDF SKRIAKEGPENLIYVSCNPSKFVLDYRNYLSKAYKIEDAVLIDMFPHTPHVEAVVKLRRR

Enzymatic activities:

Reaction Substrate Type Position
U:m5U rRNA (r) LSU/23S/prokaryotic cytosol 859

Publications:

Title Authors Journal Details PubMed Id DOI
Specificity shifts in the rRNA and tRNA nucleotide targets of archaeal and bacterial m5U methyltransferases. Auxilien S, Rasmussen A, Rose S, Brochier-Armanet C, Husson C, Fourmy D, Grosjean H, Douthwaite S RNA [details] 21051506 -

Links:

_PubMed_
Copyright © Genesilico - All rights reserved
If you have any advice or suggestions for corrections or improvements, please contact: Pietro Boccaletto