Full name: 23S rRNA (uracil-C(5))-methyltransferase RlmCD
Synonym: YefA
GI: 50401309
Orf: BSU06730
COG: COG2265
UniProt: O31503
Structures: | |
Complex:
Enzyme type: methyltransferase
Position of modification - modification: l:749(747) - m5U
l:1968(1939) - m5U

Comments:

Methylation of U747 and U1939 in B. subtilis rRNA is catalysed by a single enzyme while in E. coli two separate enzymes (RlmC and RlmD) are responsible for these two modifications.

Protein sequence:

MKMKPPVEKNEYYDVTFEDLTHEGAGVAKVQGFPIFVPNALPEEKAQIKVTRVKKGFAFGRLIELKEESP HRTDAPCPIYKQCGGCQLQHMTYEGQLLFKQKQVKDVLERIGKLDLSKVTVHPTLGMEDPWNYRNKAQVP VGEREGGLVAGFYQQRSHDIIDMSACLIQQSKNDEAVQAVKDICANYGVKAYNEERHKGWLRHIMVRYGV VTGEMMIVFITRTSDFPHKAKIIEDITAQFPHVKSIVQNINPNKTNVIFGNETNVIWGEEYIYDLIGDVK FAISARSFYQVNPEQTKVLYDKALEYAELQGEETVIDAYCGIGTISLFLAKQAKKVYGVEIVPEAIEDAK RNAELNGNTNAEFAVGEAETVIPKWYEEGITADTLVVDPPRKGCDEALLRTIVEMKPKRVVYVSCNPGTL ARDLRVLEDGGYVTREVQPVDMFPHTNHVECCVLIKLKE

Enzymatic activities:

Reaction Substrate Type Position
U:m5U rRNA (r) LSU/23S/prokaryotic cytosol 794
U:m5U rRNA (r) LSU/23S/prokaryotic cytosol 1968

Publications:

Title Authors Journal Details PubMed Id DOI
A single methyltransferase YefA (RlmCD) catalyses both m5U747 and m5U1939 modifications in Bacillus subtilis 23S rRNA. Desmolaize B, Fabret C, Bregeon D, Rose S, Grosjean H, Douthwaite S Nucleic Acids Res [details] 21824914 -

Links:

_PubMed_
Copyright © Genesilico - All rights reserved
If you have any advice or suggestions for corrections or improvements, please contact: Pietro Boccaletto