Modomics - A Database of RNA Modifications

Full name:	tRNA (cytidine(34)-2′-O)-methyltransferase
Synonym:	YibK
GI:	16131477
Orf:	b3606, JW3581
COG:	COG0219
UniProt:	P0AGJ7
Structures:	\| 4JAK \| 4JAL \|
Complex:
Enzyme type:	methyltransferase
Position of modification - modification:	t:34 - Cm t:34 - cmnm5Um

Comments:

This small SAM-dependent methyltransferase (157 amino acids) exists as an homodimer. It acts on the ribose of the wobble U or C34 of E. coli tRNALeu harboring an i6A37 modification in the anticodon loop. It allows increasing the performance of the tRNA reading the corresponding complementary codons. The enzyme is not essential for cell viability. Belongs to the SPOUT-type TrmH/TrmL subfamily.

Protein sequence:

MLNIVLYEPEIPPNTGNIIRLCANTGFRLHIIEPMGFAWDDKRLRRAGLDYHEFTAVTRHHDYRAFLEAENPQRLFALTTKGTPAHSAVSYQDGDYLMFG
PETRGLPASILDALPAEQKIRIPMVPDSRSMNLSNAVSVVVYEAWRQLGYPGAVLRD

Enzymatic activities:

Reaction	Substrate	Type	Position
U:Um	tRNA (t)	Leu/)AA/prokaryotic cytosol	34
C:Cm	tRNA (t)	Leu/BAA/prokaryotic cytosol	34
cmnm5U:cmnm5Um	tRNA (t)	Leu/)AA/prokaryotic cytosol	34

Publications:

Title	Authors	Journal	Details	PubMed Id	DOI
Enzymology of tRNA modification in the bacterial MnmEG pathway.	Armengod ME, Moukadiri I, Prado S, Ruiz-Partida R, Benitez-Paez A, Villarroya M, Lomas R, Garzon MJ, Martinez-Zamora A, Meseguer S, Navarro-Gonzalez C	Biochimie	[details]	22386868	-
YibK is the 2'-O-methyltransferase TrmL that modifies the wobble nucleotide in Escherichia coli tRNA(Leu) isoacceptors.	Benitez-Paez A, Villarroya M, Douthwaite S, Gabaldon T, Armengod ME	RNA	[details]	20855540	-
The tRNA recognition mechanism of the minimalist SPOUT methyltransferase, TrmL.	Liu RJ, Zhou M, Fang ZP, Wang M, Zhou XL, Wang ED...	Nucleic Acids Res	[details]	23804755	-
Identification of determinants for tRNA substrate recognition by Escherichia coli C/U34 2'-O-methyltransferase.	Zhou M, Long T, Fang ZP, Zhou XL, Liu RJ, Wang ED	RNA Biol.	[details]	26106808	10.1080/15476286.2015.1050576

Links:

_MetaCyc_

_MetaCyc_