Full name: tRNA (adenine(58)-N(1))-methyltransferase non-catalytic subunit TRM6
Synonym: KIAA1153, TRM6
GI: 19923475
Orf: CGI-09
COG: COG2519
UniProt: Q9UJA5
Structures: | 5CCB | 5CD1 | 5CCX |
Complex: Trm6/Trm61

Comments:

A part of heterodimeric Trm6/Trm61 MTase. The activity tested on yeast tRNAs in vitro (tRNAi Met) and on htRNA3Lys expressed in yeast cells in vivo.

Protein sequence:

MEGSGEQPGPQPQHPGDHRIRDGDFVVLKREDVFKAVQVQRRKKVTFEKQWFYLDNVIGHSYGTAFEVTS GGSLQPKKKREEPTAETKEAGTDNRNIVDDGKSQKLTQDDIKALKDKGIKGEEIVQQLIENSTTFRDKTE FAQDKYIKKKKKKYEAIITVVKPSTRILSIMYYAREPGKINHMRYDTLAQMLTLGNIRAGNKMIVMETCA GLVLGAMMERMGGFGSIIQLYPGGGPVRAATACFGFPKSFLSGLYEFPLNKVDSLLHGTFSAKMLSSEPK DSALVEESNGTLEEKQASEQENEDSMAEAPESNHPEDQETMETISQDPEHKGPKERGSKKDYIQEKQRRQ EEQRKRHLEAAALLSERNADGLIVASRFHPTPLLLSLLDFVAPSRPFVVYCQYKEPLLECYTKLRERGGV INLRLSETWLRNYQVLPDRSHPKLLMSGGGGYLLSGFTVAMDNLKADTSLKSNASTLESHETEEPAAKKR KCPESDS

Publications:

Title Authors Journal Details PubMed Id DOI
The bipartite structure of the tRNA m1A58 methyltransferase from S. cerevisiae is conserved in humans. Ozanick S, Krecic A, Andersland J, Anderson JT RNA [details] 16043508 -
Crystal Structure of the Human tRNA mA58 Methyltransferase-tRNA Complex: Refolding of Substrate tRNA allows Access to the Methylation Target. Finer-Moore J, Czudnochowski N, O'Connell JD 3rd, Wang AL, Stroud RM... J Mol Biol [details] 26470919 -
Copyright © Genesilico - All rights reserved
If you have any advice or suggestions for corrections or improvements, please contact: Pietro Boccaletto