MSFVAYEELIKEGDTAILSLGHGAMVAVRVQRGAQTQTRHGVLRHSVDLIGRPFGSKVTCGRGGWVYVLHPTPELWTLNLPHRTQILYSTDIALITMMLE LRPGSVVCESGTGSGSVSHAIIRTIAPTGHLHTVEFHQQRAEKAREEFQEHRVGRWVTVRTQDVCRSGFGVSHVADAVFLDIPSPWEAVGHAWDALKVEG GRFCSFSPCIEQVQRTCQALAARGFSELSTLEVLPQVYNVRTVSLPPPDLGTGTDGPAGSDTSPFRSGTPMKEAVGHTGYLTFATKTPG
Reaction | Substrate | Type | Position |
---|---|---|---|
A:m1A | tRNA (t) | Lys/unknown/eukaryotic cytosol | 58 |
Description | Reaction | Disease Name |
---|---|---|
TRM6/61 regulates the translation of a subset of mRNAs encoding proteins that play role in cancer. | A:m1A | Glioblastoma |
Title | Authors | Journal | Details | ||
---|---|---|---|---|---|
The bipartite structure of the tRNA m1A58 methyltransferase from S. cerevisiae is conserved in humans. | Ozanick S, Krecic A, Andersland J, Anderson JT | RNA | [details] | 16043508 | - |
Crystal Structure of the Human tRNA mA58 Methyltransferase-tRNA Complex: Refolding of Substrate tRNA allows Access to the Methylation Target. | Finer-Moore J, Czudnochowski N, O'Connell JD 3rd, Wang AL, Stroud RM... | J Mol Biol | [details] | 26470919 | - |